SlideShare uma empresa Scribd logo
1 de 25
Baixar para ler offline
Break out session: Synthetic Biology
1
Dr Philippe Gabant
Co-founder & CSO
pgabant@syngulon.com
Friday June 10, 2022
Disruptive industrial applications of Synthetic Biology
Agenda
1. Syngulon presentation
2. The importance of microbes for life on our planet
3. Syngulon’s markets
4. Which genes to fight AMR / to tune microbiota?
5. Historic view point of antimicrobials
6. Syngulon’s technology: industrial applications
7. PARAGEN collection and expansion via Synbio
8. Q&A
2
R&D Partners
Scientific Advisory Board
Pr Joseph Martial (Chairman), ULg, Liège (BE)
Pr Bruno André, ULB, Brussels (BE)
Adj-Pr Mike Chandler, University of Georgetown (USA)
Pr Pascal Hols, UCL, Louvain-la-Neuve (BE)
Pr Didier Mazel, Institut Pasteur, Paris (FR)
Pr Laurence Van Melderen, ULB, Charleroi (BE)
Pr Ruddy Wattiez, UMons, Mons (BE)
IN MEMORIAM
Dr Régis Sodoyer, ex-Sanofi Pasteur, Lyon (FR)
Collaboration with:
Universidad Complutense Madrid (UCM)
Dr. Juan Borrero 3
1. Syngulon presentation
Team
Guy Hélin, Co-founder, CEO
Dr. Philippe Gabant, Co-Founder, CSO
Dr. Mohamed El Bakkoury, CTO Yeast
Dr. Luz Perez, R&D Project Manager
Dr. Baptiste Dumont, R&D Project Manager
Félix Jaumaux, PhD Student
Dr. Anandi Martin, Senior Project Manager - Infectious Disease
Loïc Mues, R&D Scientist
Dr. Silvia Soto Diaz, R&D Project Manager
Dr. Jérôme Coppine, R&D Project Manager
Dr. Kenny Petit, R&D project manager
Dr. Jessica El Rayes, R&D project manager
Denis Dereinne, R&D Scientist
Our position in the Ecosystem
ACADEMIC PARTNERS
R&D FUNDING
CLUSTERS AND
TRADE
ASSOCIATIONS
CUSTOMERS AND
PROSPECTIVE LICENSEES
R&D PARTNERS 4
Ethanol 2G
Cosmetics
Biopharma
Animal Health
Ethanol 1G
2. The importance of microbes for life on our planet
• Microbes are the chemical biocatalysers of our ecosystem
• Microbes are collaborating and fighting with each other to reach
certain equilibrium to form communities: « microbiota »
• These microbiota have evolved to generate unique chemical
reactions via species synergies
• Human health is related to microbiota dynamic
5
3. Syngulon’s technologies address 3 markets
Technologies
Antimicrobial Resistance
Contamination
Antibiotic-free Selection
Production in a fermentation process; key markets are
biopharma and cosmetics but also enzymes;
1 (small) licensing deal with Enzymicals for diagnostic enzymes
1 signed licensing deal with industrial biotech company
Bacteriocins target the bacteria having a negative effect
on the production process; key markets are ethanol,
cooling towers, feed, animal health;
R&D partnership with TEREOS to improve industrial
fermentation / 1 large development and licensing deal
with Chinese EPPEN for feed probiotics with bacteriocins
Human pharma applications of bacteriocins as alternative
or complement to antibiotics in the context of
AntiMicrobial Resistance AMR (e.g. methicilin-resistant
Staphylococcus aureus - MRSA)
6
NDA
AntiMicrobial Resistance
7
UPDATE January 2022:
“On the basis of our predictive statistical models, there were an estimated 4.95 million (3.62–6.57) deaths associated with bacterial AMR in 2019, including 1.27
million (95% UI 0.911–1.71) deaths attributable to bacterial AMR.”
Source: “Global burden of bacterial antimicrobial resistance in 2019: a systematic analysis” based on 471 million individual records or isolates and 7585 study-location-years
The Lancet, Published Online January 20, 2022 https://doi.org/10.1016/S0140-6736(21)02724-0
Source: TACKLING DRUG-RESISTANT INFECTIONS GLOBALLY: FINAL REPORT AND RECOMMENDATIONS, May 2016
Problems created by AMR/microbiota
• Better use of our current antibiotic arsenal
• Unmet needs:
– technologies and molecules to tackle AMR
– technologies and molecules to tune microbiota
Syngulon’s mission: Balancing & controlling microbial life on earth
8
4. Which genes to fight AMR / to tune microbiota?
• (R)Explore the world of bacteriocins
- Discovered in 1925 by Belgian scientist:
“André Gratia (1893–1950): forgotten pioneer of research into antimicrobial agents” (*)
- Heterogenous group of antimicrobial peptides produced ribosomally by bacteria
- Used to kill related species to reduce competition for resources and space
- Not toxic
André Gratia
• Apply synthetic biology
9
(*) Wainwright M., J Med Biogr. 2000 Feb;8(1):39-42.
5. Historical context of the discovery of antimicrobials
Félix d'Hérelle
Prof Ernest Chain Prof. Howard Florey
Prof André Gratia
Sir Alexander Fleming Prof Frederick Twort
Antibiotics
Bacteriophages
Bacteriocins
10
André Gratia in the USA
A. Gratia with Paul de Kruif at Rockefeller Institute (New-York) in 1920 (Picture from the archives of )
11
1946
Standing: from left to right:
Prof. Selman Waksman (Rutgers University), Nobel Price of Medicine 1952 for the
discovery of streptomycin. Prof Waksman recommended the publication of this picture
with André Gratia in the book of Ph. Rhodes An outline of the history of
medicine (Butterworth, London, 1985)
Prof. Howard Florey (Oxford University), Nobel Price of Medicine 1945 shared with Sir
Alexander Fleming and Prof E.Chain for the discovery of penicillin.
Prof Jacques Trefouël (Institut Pasteur,Paris), discoverer of sulfonamides.
Prof Ernest Chain (Oxford University), Nobel Price of Medicine 1945 shared with Sir
Alexander Fleming and Prof H. Florey for the discovery of penicillin.
Prof André Gratia (University of Liège), discoverer of colicinogenic factors.
Prof E. Chain expressly requested Prof. A. Gratia to be present on his side on this
group picture.
Foreground:
Dr Pierre Frédericq (University of Liège) who showed that colicins are plasmid
encoded. Colicinogenic factors (such as plasmid colE1) were further developed to
become major tools in molecular biology.
Dr Maurice Welsch (University of Liège), developed mass production of antibiotics and
became Rector of the University of Liège.
Source: Belgian society of microbiology: M. Mergeay and G Cornelis tribute to André Gratia 12
Bacteriocins Function and Diversity
Collins, F.W.J., O’Connor, P.M., O’Sullivan, O. et al. Bacteriocin Gene-Trait matching across the complete Lactobacillus Pan-genome. Sci Rep 7, 3481 (2017).
Heilbronner, S., Krismer, B., Brötz-Oesterhelt, H. et al. The microbiome-shaping roles of bacteriocins. Nat Rev Microbiol (2021).
Bacteriocins are ecological genetic biocontol elements used by bacteria in nature
13
Bacteriocins in food applications
Fermentation of GRAS bacteria can change food taste and protect food against bacterial spoliage
Some bacteria are secreting antimicrobial compounds including peptides
Using fermentation to generate a firewall against problematic microbes
One of those peptides is Nisin that is used in food industry (E234)
14
Nisin (E234, GRAS) illustrates the potential of bacteriocins at industrial scale
Bacteriocins potential
15
1925
Production
• Genetic amenability
• Various prey spectrum
• Molecular diversity
• Cyto-friendly
• Stability
• Biological half-life
Pascal Hols, Laura Ledesma-García, Philippe Gabant and Johann Mignolet, Trends Microbiology 1685 No. of Pages 13
“Blank” chassis
Constructed by modules (parts)
Behavior code based
Non self replicative
Possible contamination by external
code
“Evolutionary” based chassis
Constructed by modules (parts)
Behavior code based
Self coding and self replicative
Possible contamination by external
code
Similarities with IT exists but fundamental differences
16
6. Syngulon’s technology: industrial applications
Synthetic Biology: “IT versus genes”
Heterogeneity in bioreactors
17
Batch 1
Yield: 75%
Batch 2
Yield: 50%
Batch 3
Yield: 90%
A
GOI
B
Batch fermentation in 200 L bioreactor
using E. coli BL21 (DE3) production strain containing a
Syngulon’s self-supporting expression plasmid
While producing the protein of interest (in blue) the
production strain also secret bacteriocins (in red) in the
fermentation medium. The population of cells containing
the Syngulon’s patented expression plasmids are therefore
inhibiting the growth of cells that loss the plasmid as well
as sensitive contaminants. Cells that contain the plasmids
also express the bacteriocin’s immunity and are therefore
immune to the bacteriocins
25
15
10
35
40
55
70
100
130
170
Recombinant
protein expression
in E. coli BL21 (DE3)
Inhibition halos due to
bacteriocins present in the
cell culture supernatant
Bacteriocin
Protein of interest
Example of a production in 200 L bioreactor with
Syngulon self-supporting expression plasmids
18
Future development: new microbial chassis ELITHE Project (convention 8527)
19
Press releases
7. The PARAGEN Collection
Physical Collection of Bacteriocin
Genes and Peptides
Relevant publications
> 100 “wild type” bacteriocins
chemically synthesized
~800 bacteriocin genes
To explore the diversity of bacteriocins we have built a collection of synthetic
genes in a standardized format allowing rapid activity measurements of
bacteriocins.
20
Int. J. Mol. Sci. 2012, 13(12), 16668-16707;
Review
Class IIa Bacteriocins: Diversity and New Developments
Yanhua Cui 1, Chao Zhang 1, Yunfeng Wang 2,*, John Shi 3, Lanwei Zhang 1,*, Zhongqing Ding 1, Xiaojun
Qu 4 and Hongyu Cui 2
21
Perez et al., Front Microbiol, 2018
Collaboration with:
Universidad Complutense Madrid (UCM)
Dr. Juan Borrero
Synbio to expand PARAGEN (1)
22
LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA
SGAFTAAGGIMALIKKYAQKKLWKQLIAALVATGMAAGVAKTIVNAVSAGMDIATALSLF
Experimental design
Mature sequence of garvicin ML
Use of split inteins
Collaboration with:
Universidad Complutense Madrid (UCM)
Dr. Juan Borrero
Synbio to expand PARAGEN (2)
23
Applying Synbio to expand PARAGEN is part of our mission
S F
S F
H
N
O N
H
O
S F
N
H
O
Mature BACTERIOCIN
IC IN SsrA
+
24
Q & A
25
Dr Philippe Gabant
Co-founder & CSO
pgabant@syngulon.com
Disruptive industrial applications of Synthetic Biology
Break out session: Synthetic Biology
Guy Hélin, Co-founder & CEO
Philippe Gabant, Co-founder & CSO
Booth 2137

Mais conteúdo relacionado

Semelhante a Syngulon - Breakout session Synthetic Biology June 10, 2022.pdf

The Role of Antibiotics and Antibiotic Resistance in Nature
The Role of Antibiotics and Antibiotic Resistance in NatureThe Role of Antibiotics and Antibiotic Resistance in Nature
The Role of Antibiotics and Antibiotic Resistance in Nature
ijtsrd
 
Bacteriophage therapy for antimicrobial resistant and biofilm forming [Autosa...
Bacteriophage therapy for antimicrobial resistant and biofilm forming [Autosa...Bacteriophage therapy for antimicrobial resistant and biofilm forming [Autosa...
Bacteriophage therapy for antimicrobial resistant and biofilm forming [Autosa...
kamal shrestha
 
“Isolation and Biochemical Characterization of Antibiotic Producing Microorga...
“Isolation and Biochemical Characterization of Antibiotic Producing Microorga...“Isolation and Biochemical Characterization of Antibiotic Producing Microorga...
“Isolation and Biochemical Characterization of Antibiotic Producing Microorga...
IOSR Journals
 

Semelhante a Syngulon - Breakout session Synthetic Biology June 10, 2022.pdf (20)

Applications of bioinformatics
Applications of bioinformaticsApplications of bioinformatics
Applications of bioinformatics
 
Application of Bioinformatics in different fields of sciences
Application of Bioinformatics in different fields of sciencesApplication of Bioinformatics in different fields of sciences
Application of Bioinformatics in different fields of sciences
 
Organoids in immunological research
Organoids in immunological researchOrganoids in immunological research
Organoids in immunological research
 
Designing of drug delivery system for biotechnology products considering stab...
Designing of drug delivery system for biotechnology products considering stab...Designing of drug delivery system for biotechnology products considering stab...
Designing of drug delivery system for biotechnology products considering stab...
 
Therapeutics principles
Therapeutics principlesTherapeutics principles
Therapeutics principles
 
History of the Forgotten Cure - Phage therapy
History of the Forgotten Cure - Phage therapyHistory of the Forgotten Cure - Phage therapy
History of the Forgotten Cure - Phage therapy
 
Pharmaceutical Biotechnology
Pharmaceutical BiotechnologyPharmaceutical Biotechnology
Pharmaceutical Biotechnology
 
The Role of Antibiotics and Antibiotic Resistance in Nature
The Role of Antibiotics and Antibiotic Resistance in NatureThe Role of Antibiotics and Antibiotic Resistance in Nature
The Role of Antibiotics and Antibiotic Resistance in Nature
 
Bacteriophage therapy for antimicrobial resistant and biofilm forming [Autosa...
Bacteriophage therapy for antimicrobial resistant and biofilm forming [Autosa...Bacteriophage therapy for antimicrobial resistant and biofilm forming [Autosa...
Bacteriophage therapy for antimicrobial resistant and biofilm forming [Autosa...
 
1. Introduction about biotechnology.pptx
1. Introduction about biotechnology.pptx1. Introduction about biotechnology.pptx
1. Introduction about biotechnology.pptx
 
Phage therapy in the 21st century
Phage therapy in the 21st centuryPhage therapy in the 21st century
Phage therapy in the 21st century
 
Plant biotechnology
Plant biotechnology Plant biotechnology
Plant biotechnology
 
What is Biotechnology.pdf
What is Biotechnology.pdfWhat is Biotechnology.pdf
What is Biotechnology.pdf
 
Evaluation of resistance profile of pseudomonas aeruginosa with reference to ...
Evaluation of resistance profile of pseudomonas aeruginosa with reference to ...Evaluation of resistance profile of pseudomonas aeruginosa with reference to ...
Evaluation of resistance profile of pseudomonas aeruginosa with reference to ...
 
B sc biotech i fob unit 1 introduction to biotechnology
B sc biotech i fob unit 1 introduction to biotechnologyB sc biotech i fob unit 1 introduction to biotechnology
B sc biotech i fob unit 1 introduction to biotechnology
 
Lecture 1.pptx
Lecture 1.pptxLecture 1.pptx
Lecture 1.pptx
 
EMERGING TRENDS IN BIOTECHNOLOGY.pptx
EMERGING TRENDS IN BIOTECHNOLOGY.pptxEMERGING TRENDS IN BIOTECHNOLOGY.pptx
EMERGING TRENDS IN BIOTECHNOLOGY.pptx
 
The Field of Biotechnology.pptx
The Field of Biotechnology.pptxThe Field of Biotechnology.pptx
The Field of Biotechnology.pptx
 
“Isolation and Biochemical Characterization of Antibiotic Producing Microorga...
“Isolation and Biochemical Characterization of Antibiotic Producing Microorga...“Isolation and Biochemical Characterization of Antibiotic Producing Microorga...
“Isolation and Biochemical Characterization of Antibiotic Producing Microorga...
 
O0568089
O0568089O0568089
O0568089
 

Último

Uncommon Grace The Autobiography of Isaac Folorunso
Uncommon Grace The Autobiography of Isaac FolorunsoUncommon Grace The Autobiography of Isaac Folorunso
Uncommon Grace The Autobiography of Isaac Folorunso
Kayode Fayemi
 
If this Giant Must Walk: A Manifesto for a New Nigeria
If this Giant Must Walk: A Manifesto for a New NigeriaIf this Giant Must Walk: A Manifesto for a New Nigeria
If this Giant Must Walk: A Manifesto for a New Nigeria
Kayode Fayemi
 
Chiulli_Aurora_Oman_Raffaele_Beowulf.pptx
Chiulli_Aurora_Oman_Raffaele_Beowulf.pptxChiulli_Aurora_Oman_Raffaele_Beowulf.pptx
Chiulli_Aurora_Oman_Raffaele_Beowulf.pptx
raffaeleoman
 
Bring back lost lover in USA, Canada ,Uk ,Australia ,London Lost Love Spell C...
Bring back lost lover in USA, Canada ,Uk ,Australia ,London Lost Love Spell C...Bring back lost lover in USA, Canada ,Uk ,Australia ,London Lost Love Spell C...
Bring back lost lover in USA, Canada ,Uk ,Australia ,London Lost Love Spell C...
amilabibi1
 

Último (18)

Dreaming Marissa Sánchez Music Video Treatment
Dreaming Marissa Sánchez Music Video TreatmentDreaming Marissa Sánchez Music Video Treatment
Dreaming Marissa Sánchez Music Video Treatment
 
Aesthetic Colaba Mumbai Cst Call girls 📞 7738631006 Grant road Call Girls ❤️-...
Aesthetic Colaba Mumbai Cst Call girls 📞 7738631006 Grant road Call Girls ❤️-...Aesthetic Colaba Mumbai Cst Call girls 📞 7738631006 Grant road Call Girls ❤️-...
Aesthetic Colaba Mumbai Cst Call girls 📞 7738631006 Grant road Call Girls ❤️-...
 
Report Writing Webinar Training
Report Writing Webinar TrainingReport Writing Webinar Training
Report Writing Webinar Training
 
ICT role in 21st century education and it's challenges.pdf
ICT role in 21st century education and it's challenges.pdfICT role in 21st century education and it's challenges.pdf
ICT role in 21st century education and it's challenges.pdf
 
Uncommon Grace The Autobiography of Isaac Folorunso
Uncommon Grace The Autobiography of Isaac FolorunsoUncommon Grace The Autobiography of Isaac Folorunso
Uncommon Grace The Autobiography of Isaac Folorunso
 
Dreaming Music Video Treatment _ Project & Portfolio III
Dreaming Music Video Treatment _ Project & Portfolio IIIDreaming Music Video Treatment _ Project & Portfolio III
Dreaming Music Video Treatment _ Project & Portfolio III
 
My Presentation "In Your Hands" by Halle Bailey
My Presentation "In Your Hands" by Halle BaileyMy Presentation "In Your Hands" by Halle Bailey
My Presentation "In Your Hands" by Halle Bailey
 
Causes of poverty in France presentation.pptx
Causes of poverty in France presentation.pptxCauses of poverty in France presentation.pptx
Causes of poverty in France presentation.pptx
 
AWS Data Engineer Associate (DEA-C01) Exam Dumps 2024.pdf
AWS Data Engineer Associate (DEA-C01) Exam Dumps 2024.pdfAWS Data Engineer Associate (DEA-C01) Exam Dumps 2024.pdf
AWS Data Engineer Associate (DEA-C01) Exam Dumps 2024.pdf
 
Busty Desi⚡Call Girls in Sector 51 Noida Escorts >༒8448380779 Escort Service-...
Busty Desi⚡Call Girls in Sector 51 Noida Escorts >༒8448380779 Escort Service-...Busty Desi⚡Call Girls in Sector 51 Noida Escorts >༒8448380779 Escort Service-...
Busty Desi⚡Call Girls in Sector 51 Noida Escorts >༒8448380779 Escort Service-...
 
Digital collaboration with Microsoft 365 as extension of Drupal
Digital collaboration with Microsoft 365 as extension of DrupalDigital collaboration with Microsoft 365 as extension of Drupal
Digital collaboration with Microsoft 365 as extension of Drupal
 
Thirunelveli call girls Tamil escorts 7877702510
Thirunelveli call girls Tamil escorts 7877702510Thirunelveli call girls Tamil escorts 7877702510
Thirunelveli call girls Tamil escorts 7877702510
 
lONG QUESTION ANSWER PAKISTAN STUDIES10.
lONG QUESTION ANSWER PAKISTAN STUDIES10.lONG QUESTION ANSWER PAKISTAN STUDIES10.
lONG QUESTION ANSWER PAKISTAN STUDIES10.
 
Sector 62, Noida Call girls :8448380779 Noida Escorts | 100% verified
Sector 62, Noida Call girls :8448380779 Noida Escorts | 100% verifiedSector 62, Noida Call girls :8448380779 Noida Escorts | 100% verified
Sector 62, Noida Call girls :8448380779 Noida Escorts | 100% verified
 
If this Giant Must Walk: A Manifesto for a New Nigeria
If this Giant Must Walk: A Manifesto for a New NigeriaIf this Giant Must Walk: A Manifesto for a New Nigeria
If this Giant Must Walk: A Manifesto for a New Nigeria
 
Chiulli_Aurora_Oman_Raffaele_Beowulf.pptx
Chiulli_Aurora_Oman_Raffaele_Beowulf.pptxChiulli_Aurora_Oman_Raffaele_Beowulf.pptx
Chiulli_Aurora_Oman_Raffaele_Beowulf.pptx
 
The workplace ecosystem of the future 24.4.2024 Fabritius_share ii.pdf
The workplace ecosystem of the future 24.4.2024 Fabritius_share ii.pdfThe workplace ecosystem of the future 24.4.2024 Fabritius_share ii.pdf
The workplace ecosystem of the future 24.4.2024 Fabritius_share ii.pdf
 
Bring back lost lover in USA, Canada ,Uk ,Australia ,London Lost Love Spell C...
Bring back lost lover in USA, Canada ,Uk ,Australia ,London Lost Love Spell C...Bring back lost lover in USA, Canada ,Uk ,Australia ,London Lost Love Spell C...
Bring back lost lover in USA, Canada ,Uk ,Australia ,London Lost Love Spell C...
 

Syngulon - Breakout session Synthetic Biology June 10, 2022.pdf

  • 1. Break out session: Synthetic Biology 1 Dr Philippe Gabant Co-founder & CSO pgabant@syngulon.com Friday June 10, 2022 Disruptive industrial applications of Synthetic Biology
  • 2. Agenda 1. Syngulon presentation 2. The importance of microbes for life on our planet 3. Syngulon’s markets 4. Which genes to fight AMR / to tune microbiota? 5. Historic view point of antimicrobials 6. Syngulon’s technology: industrial applications 7. PARAGEN collection and expansion via Synbio 8. Q&A 2
  • 3. R&D Partners Scientific Advisory Board Pr Joseph Martial (Chairman), ULg, Liège (BE) Pr Bruno André, ULB, Brussels (BE) Adj-Pr Mike Chandler, University of Georgetown (USA) Pr Pascal Hols, UCL, Louvain-la-Neuve (BE) Pr Didier Mazel, Institut Pasteur, Paris (FR) Pr Laurence Van Melderen, ULB, Charleroi (BE) Pr Ruddy Wattiez, UMons, Mons (BE) IN MEMORIAM Dr Régis Sodoyer, ex-Sanofi Pasteur, Lyon (FR) Collaboration with: Universidad Complutense Madrid (UCM) Dr. Juan Borrero 3 1. Syngulon presentation Team Guy Hélin, Co-founder, CEO Dr. Philippe Gabant, Co-Founder, CSO Dr. Mohamed El Bakkoury, CTO Yeast Dr. Luz Perez, R&D Project Manager Dr. Baptiste Dumont, R&D Project Manager Félix Jaumaux, PhD Student Dr. Anandi Martin, Senior Project Manager - Infectious Disease Loïc Mues, R&D Scientist Dr. Silvia Soto Diaz, R&D Project Manager Dr. Jérôme Coppine, R&D Project Manager Dr. Kenny Petit, R&D project manager Dr. Jessica El Rayes, R&D project manager Denis Dereinne, R&D Scientist
  • 4. Our position in the Ecosystem ACADEMIC PARTNERS R&D FUNDING CLUSTERS AND TRADE ASSOCIATIONS CUSTOMERS AND PROSPECTIVE LICENSEES R&D PARTNERS 4 Ethanol 2G Cosmetics Biopharma Animal Health Ethanol 1G
  • 5. 2. The importance of microbes for life on our planet • Microbes are the chemical biocatalysers of our ecosystem • Microbes are collaborating and fighting with each other to reach certain equilibrium to form communities: « microbiota » • These microbiota have evolved to generate unique chemical reactions via species synergies • Human health is related to microbiota dynamic 5
  • 6. 3. Syngulon’s technologies address 3 markets Technologies Antimicrobial Resistance Contamination Antibiotic-free Selection Production in a fermentation process; key markets are biopharma and cosmetics but also enzymes; 1 (small) licensing deal with Enzymicals for diagnostic enzymes 1 signed licensing deal with industrial biotech company Bacteriocins target the bacteria having a negative effect on the production process; key markets are ethanol, cooling towers, feed, animal health; R&D partnership with TEREOS to improve industrial fermentation / 1 large development and licensing deal with Chinese EPPEN for feed probiotics with bacteriocins Human pharma applications of bacteriocins as alternative or complement to antibiotics in the context of AntiMicrobial Resistance AMR (e.g. methicilin-resistant Staphylococcus aureus - MRSA) 6 NDA
  • 7. AntiMicrobial Resistance 7 UPDATE January 2022: “On the basis of our predictive statistical models, there were an estimated 4.95 million (3.62–6.57) deaths associated with bacterial AMR in 2019, including 1.27 million (95% UI 0.911–1.71) deaths attributable to bacterial AMR.” Source: “Global burden of bacterial antimicrobial resistance in 2019: a systematic analysis” based on 471 million individual records or isolates and 7585 study-location-years The Lancet, Published Online January 20, 2022 https://doi.org/10.1016/S0140-6736(21)02724-0 Source: TACKLING DRUG-RESISTANT INFECTIONS GLOBALLY: FINAL REPORT AND RECOMMENDATIONS, May 2016
  • 8. Problems created by AMR/microbiota • Better use of our current antibiotic arsenal • Unmet needs: – technologies and molecules to tackle AMR – technologies and molecules to tune microbiota Syngulon’s mission: Balancing & controlling microbial life on earth 8
  • 9. 4. Which genes to fight AMR / to tune microbiota? • (R)Explore the world of bacteriocins - Discovered in 1925 by Belgian scientist: “André Gratia (1893–1950): forgotten pioneer of research into antimicrobial agents” (*) - Heterogenous group of antimicrobial peptides produced ribosomally by bacteria - Used to kill related species to reduce competition for resources and space - Not toxic André Gratia • Apply synthetic biology 9 (*) Wainwright M., J Med Biogr. 2000 Feb;8(1):39-42.
  • 10. 5. Historical context of the discovery of antimicrobials Félix d'Hérelle Prof Ernest Chain Prof. Howard Florey Prof André Gratia Sir Alexander Fleming Prof Frederick Twort Antibiotics Bacteriophages Bacteriocins 10
  • 11. André Gratia in the USA A. Gratia with Paul de Kruif at Rockefeller Institute (New-York) in 1920 (Picture from the archives of ) 11
  • 12. 1946 Standing: from left to right: Prof. Selman Waksman (Rutgers University), Nobel Price of Medicine 1952 for the discovery of streptomycin. Prof Waksman recommended the publication of this picture with André Gratia in the book of Ph. Rhodes An outline of the history of medicine (Butterworth, London, 1985) Prof. Howard Florey (Oxford University), Nobel Price of Medicine 1945 shared with Sir Alexander Fleming and Prof E.Chain for the discovery of penicillin. Prof Jacques Trefouël (Institut Pasteur,Paris), discoverer of sulfonamides. Prof Ernest Chain (Oxford University), Nobel Price of Medicine 1945 shared with Sir Alexander Fleming and Prof H. Florey for the discovery of penicillin. Prof André Gratia (University of Liège), discoverer of colicinogenic factors. Prof E. Chain expressly requested Prof. A. Gratia to be present on his side on this group picture. Foreground: Dr Pierre Frédericq (University of Liège) who showed that colicins are plasmid encoded. Colicinogenic factors (such as plasmid colE1) were further developed to become major tools in molecular biology. Dr Maurice Welsch (University of Liège), developed mass production of antibiotics and became Rector of the University of Liège. Source: Belgian society of microbiology: M. Mergeay and G Cornelis tribute to André Gratia 12
  • 13. Bacteriocins Function and Diversity Collins, F.W.J., O’Connor, P.M., O’Sullivan, O. et al. Bacteriocin Gene-Trait matching across the complete Lactobacillus Pan-genome. Sci Rep 7, 3481 (2017). Heilbronner, S., Krismer, B., Brötz-Oesterhelt, H. et al. The microbiome-shaping roles of bacteriocins. Nat Rev Microbiol (2021). Bacteriocins are ecological genetic biocontol elements used by bacteria in nature 13
  • 14. Bacteriocins in food applications Fermentation of GRAS bacteria can change food taste and protect food against bacterial spoliage Some bacteria are secreting antimicrobial compounds including peptides Using fermentation to generate a firewall against problematic microbes One of those peptides is Nisin that is used in food industry (E234) 14 Nisin (E234, GRAS) illustrates the potential of bacteriocins at industrial scale
  • 15. Bacteriocins potential 15 1925 Production • Genetic amenability • Various prey spectrum • Molecular diversity • Cyto-friendly • Stability • Biological half-life Pascal Hols, Laura Ledesma-García, Philippe Gabant and Johann Mignolet, Trends Microbiology 1685 No. of Pages 13
  • 16. “Blank” chassis Constructed by modules (parts) Behavior code based Non self replicative Possible contamination by external code “Evolutionary” based chassis Constructed by modules (parts) Behavior code based Self coding and self replicative Possible contamination by external code Similarities with IT exists but fundamental differences 16 6. Syngulon’s technology: industrial applications Synthetic Biology: “IT versus genes”
  • 17. Heterogeneity in bioreactors 17 Batch 1 Yield: 75% Batch 2 Yield: 50% Batch 3 Yield: 90% A GOI B
  • 18. Batch fermentation in 200 L bioreactor using E. coli BL21 (DE3) production strain containing a Syngulon’s self-supporting expression plasmid While producing the protein of interest (in blue) the production strain also secret bacteriocins (in red) in the fermentation medium. The population of cells containing the Syngulon’s patented expression plasmids are therefore inhibiting the growth of cells that loss the plasmid as well as sensitive contaminants. Cells that contain the plasmids also express the bacteriocin’s immunity and are therefore immune to the bacteriocins 25 15 10 35 40 55 70 100 130 170 Recombinant protein expression in E. coli BL21 (DE3) Inhibition halos due to bacteriocins present in the cell culture supernatant Bacteriocin Protein of interest Example of a production in 200 L bioreactor with Syngulon self-supporting expression plasmids 18 Future development: new microbial chassis ELITHE Project (convention 8527)
  • 20. 7. The PARAGEN Collection Physical Collection of Bacteriocin Genes and Peptides Relevant publications > 100 “wild type” bacteriocins chemically synthesized ~800 bacteriocin genes To explore the diversity of bacteriocins we have built a collection of synthetic genes in a standardized format allowing rapid activity measurements of bacteriocins. 20
  • 21. Int. J. Mol. Sci. 2012, 13(12), 16668-16707; Review Class IIa Bacteriocins: Diversity and New Developments Yanhua Cui 1, Chao Zhang 1, Yunfeng Wang 2,*, John Shi 3, Lanwei Zhang 1,*, Zhongqing Ding 1, Xiaojun Qu 4 and Hongyu Cui 2 21
  • 22. Perez et al., Front Microbiol, 2018 Collaboration with: Universidad Complutense Madrid (UCM) Dr. Juan Borrero Synbio to expand PARAGEN (1) 22
  • 23. LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA SGAFTAAGGIMALIKKYAQKKLWKQLIAALVATGMAAGVAKTIVNAVSAGMDIATALSLF Experimental design Mature sequence of garvicin ML Use of split inteins Collaboration with: Universidad Complutense Madrid (UCM) Dr. Juan Borrero Synbio to expand PARAGEN (2) 23
  • 24. Applying Synbio to expand PARAGEN is part of our mission S F S F H N O N H O S F N H O Mature BACTERIOCIN IC IN SsrA + 24
  • 25. Q & A 25 Dr Philippe Gabant Co-founder & CSO pgabant@syngulon.com Disruptive industrial applications of Synthetic Biology Break out session: Synthetic Biology Guy Hélin, Co-founder & CEO Philippe Gabant, Co-founder & CSO Booth 2137