SlideShare uma empresa Scribd logo
1 de 51
Reference Data Integration:
A Strategy For The Future
Barry Smith
National Center for Ontological Research
University at Buffalo
presented at FIMA, March 21, 2012
1
Who am I?
National Center for Biomedical Ontology
based in Stanford Medical School, the Mayo Clinic
and Buffalo Department of Philosophy
2
• Cleveland Clinic Semantic Database
• Duke University Health System
• University of Pittsburgh Medical Center
• German Federal Ministry of Health
• European Union eHealth Directorate
• Plant Genome Research Resource
• Protein Information Resource
Who am I?
National Center for Ontological Research (http://ncor.us)
• Joint Warfighting Center, US Joint Forces Command
• Intelligence and Information Warfare Directorate
(I2WD)
• US Department of the Army Net-Centric Data
Strategy Center of Excellence
• NextGen (Next Generation Air Transportation
System) Ontology Team
• National Nuclear Security Administration (NNSA),
Department of Energy
3
Some questions
• How to find data?
• How to understand data when you find it?
• How to use data when you find it?
• How to compare and integrate with other data?
• How to avoid data silos?
4
The Web (net-centricity) as part of the
solution
• You build a site
• Others discover the site and they link to it
• The more they link, the more well known the
page becomes (Google …)
• Your data becomes discoverable
5
1. Make your data available in a standard way
on the Web
2. Use controlled vocabularies (‘ontologies’) to
capture common meanings, in ways
understandable to both humans and
computers – Web Ontology Language
(OWL)
3. Build links among the datasets to create a
‘web of data’
The roots of Semantic Technology
Controlled vocabularies for tagging
(‘annotating’) data
• Hardware changes rapidly
• Organizations rapidly forming and
disbanding
• Data is exploding
• Meanings of common words change slowly
• Use web architecture to annotate exploding
data stores using ontologies to capture
these common meanings in a stable way
7
Where we stand today
• increasing availability of semantically enhanced
data and semantic software
• increasing use of XML, RDF, OWL in attempts to
create useful integration of on-line data and
information
• “Linked Open Data” the New Big Thing
8
Ontology success stories, and some
reasons for failure
•
9
as of September 2010
The problem: the more Semantic
Technology is successful, they more it fails
The original idea was to break down silos via
common controlled vocabularies for the tagging
of data
The very success of the approach leads to the
creation of ever new controlled vocabularies –
semantic silos – as ever more ontologies are
created in ad hoc ways
The Semantic Web framework as currently
conceived and governed by the W3C yields
minimal standardization
Multiplying (Meta)data registries are creating
data cemeteries
11
NCBO Bioportal (Ontology Registry)
12
13/24
14/24
Reasons for this effect
• Low incentives for reuse of existing ontologies
• Each organization wants its own ontology
• Poor licensing regime, poor standards, poor
training
• People think: Information technology (hardware)
is changing constantly, so it’s not worth the effort
of getting things right
• People have egos: “We have done it this way for
30 years, we are not going to change now”
15
Why should you care?
• when they are many ad hoc systems, average
quality will be low
• constant need for ad hoc repair through
manual effort
• DoD alone spends $6 billion per annum on
this problem
• regulatory agencies are recognizing the need
for common controlled vocabularies
16/24
So now people are scrambling
• to learn how to create ontologies
• serious lag in creating trained expertise
• poor quality coding leads to poor quality
ontologies
• poor quality ontology management
17
How to do it right?
• how create an incremental, evolutionary
process, where what is good survives ?
• how to bring about ontology death ?
A success story from biology
18
Old biology data
19/
MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYED
EKSGLIKVVKFRTGAMDRKRSFEKVVISVMVGKNVKKFLTFVEDEPDF
QGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNE
LSFRVLERCHEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGY
NLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERLKRDLCPRKPIEIKY
FSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSIT
NEEPIIPSVDEHGLKVCKLRSPNTPRRLRKTLDAVKALLVSSCACTARD
LDIFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISLLAF
AGPQRNVYVDDTTRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVT
VLRQMQICALGNSYDAFNHDPWMDVVGFEDPNQVTNRDISRIVLY
SYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGR
HCVGSRFETDLYESATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLL
New biology data
0
200
400
600
800
1000
1200
2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010
AxisTitle
Series 1
Ontology in PubMed
By far the most successful: GO (Gene Ontology)
22
23
what cellular component?
what molecular function?
what biological process?
the Gene Ontology is not an ontology of ge
arson lw n3d ...
t_LW_n3 d_5p_...
Colored by: Copy of Copy of C5_RMA (Defa...
Gene List: all genes (1 4010)
attacked
time
control
Puparial adhesion
Molting cycle
hemocyanin
Defense response
Immune response
Response to stimulus
Toll regulated genes
JAK-STAT regulated genes
Immune response
Toll regulated genes
Amino acid catabolism
Lipid metobolism
Peptidase activity
Protein catabloism
Immune response
e Tree: pearson lw n3d ...
lassification: Set_LW_n3d_5p_...
Colored by: Copy of Copy of C5_RMA (Defa...
Gene List: all genes (14010)
Microarray data
shows changed
expression of
thousands of genes.
How will you spot
the patterns?
24
Why is GO successful
• built by bench biologists
• multi-species, multi-disciplinary, open source
• compare use of kilograms, meters, seconds in
formulating experimental results
• natural language and logical definitions for all
terms
• initially low-tech to ensure aggressive use and
testing
25
now used not just in
biology but also in
hospital research
26
Lab / pathology data
EHR data
Clinical trial data
Family history data
Medical imaging
Microarray data
Model organism data
Flow cytometry
Mass spec
Genotype / SNP data
How will you spot the patterns?
How will you find the data you
need?
27
 over 11 million annotations relating
UniProt, Ensembl and other databases to terms in
the GO
28
29
Hierarchical view representing
relations between represented
types
~ $200 mill. invested in the GO so far
A new kind of biomedical research
Over 11 million GO annotations to biomedical
research literature freely available on the web
Powerful software tool support for navigating
this data means that what used to take
researchers months of data comparison effort,
can now be performed in milliseconds
30
If controlled vocabularies are to serve
to remove silos
they have to be respected by many owners of
data as resources that ensure accurate
description of their data
– GO maintained not by computer scientists but
by biologists
they have to be willingly used in annotations by
many owners of data
they have to be maintained by persons who are
trained in common principles of ontology
maintenance
31
32
The new profession of biocurator
GO has been amazingly successful
Has created a community consensus
Has created a web of feedback loops where
users of the GO can easily report errors
and gaps
Has identified principles for successful
ontology management
Indispensable to every drug company and
every biology lab
33
But GO is limited in its scope
it covers only generic biological entities of three
sorts:
–cellular components
–molecular functions
–biological processes
no diseases, symptoms, disease
biomarkers, protein interactions, experimental
processes …
34
Extending the GO methodology to
other domains of biology and
medicine
35
RELATION
TO TIME
GRANULARITY
CONTINUANT OCCURRENT
INDEPENDENT DEPENDENT
ORGAN AND
ORGANISM
Organism
(NCBI
Taxonomy)
Anatomical
Entity
(FMA,
CARO)
Organ
Function
(FMP, CPRO) Phenotypic
Quality
(PaTO)
Biological
Process
(GO)
CELL AND
CELLULAR
COMPONENT
Cell
(CL)
Cellular
Component
(FMA, GO)
Cellular
Function
(GO)
MOLECULE
Molecule
(ChEBI, SO,
RnaO, PrO)
Molecular Function
(GO)
Molecular Process
(GO)
OBO (Open Biomedical Ontology) Foundry proposal
(Gene Ontology in yellow) 36
RELATION
TO TIME
GRANULARITY
CONTINUANT OCCURRENT
INDEPENDENT DEPENDENT
ORGAN AND
ORGANISM
Organism
(NCBI
Taxonomy)
Anatomical
Entity
(FMA,
CARO)
Organ
Function
(FMP, CPRO) Phenotypic
Quality
(PaTO)
Biological
Process
(GO)
CELL AND
CELLULAR
COMPONENT
Cell
(CL)
Cellular
Component
(FMA, GO)
Cellular
Function
(GO)
MOLECULE
Molecule
(ChEBI, SO,
RnaO, PrO)
Molecular Function
(GO)
Molecular Process
(GO)
The strategy of orthogonal modules
37
Ontology Scope URL Custodians
Cell Ontology
(CL)
cell types from prokaryotes
to mammals
obo.sourceforge.net/cgi-
bin/detail.cgi?cell
Jonathan Bard, Michael
Ashburner, Oliver Hofman
Chemical Entities of Bio-
logical Interest (ChEBI)
molecular entities ebi.ac.uk/chebi
Paula Dematos,
Rafael Alcantara
Common Anatomy Refer-
ence Ontology (CARO)
anatomical structures in
human and model organisms
(under development)
Melissa Haendel, Terry
Hayamizu, Cornelius Rosse,
David Sutherland,
Foundational Model of
Anatomy (FMA)
structure of the human body
fma.biostr.washington.
edu
JLV Mejino Jr.,
Cornelius Rosse
Functional Genomics
Investigation Ontology
(FuGO)
design, protocol, data
instrumentation, and analysis
fugo.sf.net FuGO Working Group
Gene Ontology
(GO)
cellular components,
molecular functions,
biological processes
www.geneontology.org Gene Ontology Consortium
Phenotypic Quality
Ontology
(PaTO)
qualities of anatomical
structures
obo.sourceforge.net/cgi
-bin/ detail.cgi?
attribute_and_value
Michael Ashburner, Suzanna
Lewis, Georgios Gkoutos
Protein Ontology
(PrO)
protein types and
modifications
(under development) Protein Ontology Consortium
Relation Ontology (RO) relations obo.sf.net/relationship Barry Smith, Chris Mungall
RNA Ontology
(RnaO)
three-dimensional RNA
structures
(under development) RNA Ontology Consortium
Sequence Ontology
(SO)
properties and features of
nucleic sequences
song.sf.net Karen Eilbeck
How to recreate the success of the
GO in other areas
1. create a portal for sharing of information
about existing controlled vocabularies, needs
and institutions operating in a given area
2. create a library of ontologies in this area
3. create a consortium of developers of these
ontologies who agree to pool their efforts to
create a single set of non-overlapping
ontology modules
– one ontology for each sub-area
39
40
NextGen Ontology Portal
Portal
CommunitiesSearch
Ontology Library
NextGen
Enterprise
Ontology
Ontology Portal
• Two-Tiered Registry
– NextGen Ontology – consist of
vetted ontologies
– Ontology Library – open to the
wider community
• Ontology Metadata
– Ontology owner, domain, and
location
• Ontology Search*
– Support ontology discovery
 Developers commit in advance to
collaborating with developers of ontologies
in adjacent domains and
 to working to ensure that, for each
domain, there is community convergence on
a single ontology
http://obofoundry.org
The OBO Foundry: a step-by-
step, principles-based approach
41
OBO Foundry Principles
 Common governance
 Common training
 Robust versioning
 Common architecture
42
Anatomy Ontology
(FMA*, CARO)
Environment
Ontology
(EnvO)
Infectious
Disease
Ontology
(IDO*)
Biological
Process
Ontology (GO*)
Cell
Ontology
(CL)
Cellular
Component
Ontology
(FMA*, GO*) Phenotypic
Quality
Ontology
(PaTO)
Subcellular Anatomy Ontology (SAO)
Sequence Ontology
(SO*) Molecular
Function
(GO*)Protein Ontology
(PRO*)
OBO Foundry Modular Organization
top level
mid-level
domain level
Information Artifact
Ontology
(IAO)
Ontology for Biomedical
Investigations
(OBI)
Ontology of General
Medical Science
(OGMS)
Basic Formal Ontology (BFO)
43
UCore 2.0 / UCore SL
Extension Strategy
44
top level
mid-level
domain
level
Military domain ontologies as extensions of the
Universal Core Semantic Layer
Existing efforts to create modular
ontology suites
NASA Sweet Ontologies
Military Intelligence Ontology Foundry
Planned OMG efforts:
• OMG (CIA) Financial Event Ontology
• Semantic Layer for ISO 20022 (Financial
Industry Message Scheme)
46
Example:
Financial Securities Ontology
Mike Bennett (2007)
Basic principles of ontology
development
– for formulating definitions
– of modularity
– of user feedback for error correction and gap
identification
– for ensuring compatibility between modules
– for using ontologies to annotate legacy data
– for using ontologies to create new data
– for developing user-specific views
Modularity designed to ensure
• non-redundancy
• annotations can be additive
• division of labor among SMEs
• lessons learned in one module can benefit work on
other modules
• transferrable training
• motivation of SME users
49
How the FIMA Reference Data
community should solve this problem?
Major financial institutions
Major software vendors
Major data management companies
EDMC and government principals
– should pool information about the controlled vocabularies
which already exist
– create a common library of these controlled vocabularies
– create a subset of thought leaders who agree to pool their
efforts in the creation of a suite of ontology modules for
common use
– create a strategy to disseminate and evolve the selected
modules
– create a governance strategy to manage the modules over time
– allow bad ontologies to die
Urgent need for trained ontologists
Severe shortage of persons with the needed
expertise
University at Buffalo Online Training and
Certification Program for Ontologists
for details: phismith@buffalo.edu

Mais conteúdo relacionado

Mais procurados

Data Visualization And Annotation Workshop at Biocuration 2015
Data Visualization And Annotation Workshop at Biocuration 2015Data Visualization And Annotation Workshop at Biocuration 2015
Data Visualization And Annotation Workshop at Biocuration 2015
Monica Munoz-Torres
 

Mais procurados (20)

Ai and biology
Ai and biologyAi and biology
Ai and biology
 
Uses of Artificial Intelligence in Bioinformatics
Uses of Artificial Intelligence in BioinformaticsUses of Artificial Intelligence in Bioinformatics
Uses of Artificial Intelligence in Bioinformatics
 
Data Visualization And Annotation Workshop at Biocuration 2015
Data Visualization And Annotation Workshop at Biocuration 2015Data Visualization And Annotation Workshop at Biocuration 2015
Data Visualization And Annotation Workshop at Biocuration 2015
 
Bioinformatics applications and challenges
Bioinformatics applications and challengesBioinformatics applications and challenges
Bioinformatics applications and challenges
 
International Cancer Genomics Consortium (ICGC) Data Coordinating Center
International Cancer Genomics Consortium (ICGC) Data Coordinating CenterInternational Cancer Genomics Consortium (ICGC) Data Coordinating Center
International Cancer Genomics Consortium (ICGC) Data Coordinating Center
 
JALANov2000
JALANov2000JALANov2000
JALANov2000
 
Bioinformatics
BioinformaticsBioinformatics
Bioinformatics
 
Scott Edmunds & Mendel Wong, Citizen Science #101. HKU MPA lecuture
Scott Edmunds & Mendel Wong, Citizen Science #101. HKU MPA lecutureScott Edmunds & Mendel Wong, Citizen Science #101. HKU MPA lecuture
Scott Edmunds & Mendel Wong, Citizen Science #101. HKU MPA lecuture
 
Overpromise of AI in Drug Discovery
Overpromise of AI in Drug DiscoveryOverpromise of AI in Drug Discovery
Overpromise of AI in Drug Discovery
 
Brief introduction to Bioinformatics
Brief introduction to BioinformaticsBrief introduction to Bioinformatics
Brief introduction to Bioinformatics
 
Bioinformatics
BioinformaticsBioinformatics
Bioinformatics
 
Ouellette icgc toronto_oct2012_fged_ver02
Ouellette icgc toronto_oct2012_fged_ver02Ouellette icgc toronto_oct2012_fged_ver02
Ouellette icgc toronto_oct2012_fged_ver02
 
Bioinformatics Information Sources
Bioinformatics Information SourcesBioinformatics Information Sources
Bioinformatics Information Sources
 
B.sc biochem i bobi u-1 introduction to bioinformatics
B.sc biochem i bobi u-1 introduction to bioinformaticsB.sc biochem i bobi u-1 introduction to bioinformatics
B.sc biochem i bobi u-1 introduction to bioinformatics
 
Genomics2 Phenomics Complete
Genomics2 Phenomics CompleteGenomics2 Phenomics Complete
Genomics2 Phenomics Complete
 
Bioinformatics
BioinformaticsBioinformatics
Bioinformatics
 
Bioinformatics in the Era of Open Science and Big Data
Bioinformatics in the Era of Open Science and Big DataBioinformatics in the Era of Open Science and Big Data
Bioinformatics in the Era of Open Science and Big Data
 
agINFRA Germplasm metadata analysis
agINFRA Germplasm metadata analysisagINFRA Germplasm metadata analysis
agINFRA Germplasm metadata analysis
 
Bioinformatics
BioinformaticsBioinformatics
Bioinformatics
 
Genentech icgc 2015
Genentech icgc 2015Genentech icgc 2015
Genentech icgc 2015
 

Destaque

Country risk analysis
Country risk analysisCountry risk analysis
Country risk analysis
ragini2001
 

Destaque (12)

Financial Regulation Ontology (FRO) tutorial chapter 1 into
Financial Regulation Ontology (FRO) tutorial chapter 1 intoFinancial Regulation Ontology (FRO) tutorial chapter 1 into
Financial Regulation Ontology (FRO) tutorial chapter 1 into
 
Financial Industry Semantics and Ontologies
Financial Industry Semantics and OntologiesFinancial Industry Semantics and Ontologies
Financial Industry Semantics and Ontologies
 
The XBRL Bank Call Report (FFIEC 031) in FIBO
The XBRL Bank Call Report (FFIEC 031) in FIBOThe XBRL Bank Call Report (FFIEC 031) in FIBO
The XBRL Bank Call Report (FFIEC 031) in FIBO
 
Semantic Applications for Financial Services
Semantic Applications for Financial ServicesSemantic Applications for Financial Services
Semantic Applications for Financial Services
 
FIBO Presentation 2015 extended
FIBO Presentation 2015 extendedFIBO Presentation 2015 extended
FIBO Presentation 2015 extended
 
Semantics in Financial Services -David Newman
Semantics in Financial Services -David NewmanSemantics in Financial Services -David Newman
Semantics in Financial Services -David Newman
 
FIBO & Schema.org
FIBO & Schema.orgFIBO & Schema.org
FIBO & Schema.org
 
20141003 fibo status update for ofdg
20141003 fibo status update for ofdg20141003 fibo status update for ofdg
20141003 fibo status update for ofdg
 
How to Create a Golden Ontology
How to Create a Golden OntologyHow to Create a Golden Ontology
How to Create a Golden Ontology
 
Seminer dersi
Seminer dersiSeminer dersi
Seminer dersi
 
Introduction to the Semantic Web
Introduction to the Semantic WebIntroduction to the Semantic Web
Introduction to the Semantic Web
 
Country risk analysis
Country risk analysisCountry risk analysis
Country risk analysis
 

Semelhante a Ontology for the Financial Services Industry

Ontologies: What Librarians Need to Know
Ontologies: What Librarians Need to KnowOntologies: What Librarians Need to Know
Ontologies: What Librarians Need to Know
Barry Smith
 
Conference-The-future-will-be-digital-and-biology-but who-will-lead-watson-go...
Conference-The-future-will-be-digital-and-biology-but who-will-lead-watson-go...Conference-The-future-will-be-digital-and-biology-but who-will-lead-watson-go...
Conference-The-future-will-be-digital-and-biology-but who-will-lead-watson-go...
Manuel GEA - Bio-Modeling Systems
 
Ben Goertzel AIs, Superflies and the Path to Immortality - singsum au 2011
Ben Goertzel AIs, Superflies and the Path to Immortality - singsum au 2011Ben Goertzel AIs, Superflies and the Path to Immortality - singsum au 2011
Ben Goertzel AIs, Superflies and the Path to Immortality - singsum au 2011
Adam Ford
 

Semelhante a Ontology for the Financial Services Industry (20)

Introduction to Gene Mining Part A: BLASTn-off!
Introduction to Gene Mining Part A: BLASTn-off!Introduction to Gene Mining Part A: BLASTn-off!
Introduction to Gene Mining Part A: BLASTn-off!
 
Ontologies: What Librarians Need to Know
Ontologies: What Librarians Need to KnowOntologies: What Librarians Need to Know
Ontologies: What Librarians Need to Know
 
Will Biomedical Research Fundamentally Change in the Era of Big Data?
Will Biomedical Research Fundamentally Change in the Era of Big Data?Will Biomedical Research Fundamentally Change in the Era of Big Data?
Will Biomedical Research Fundamentally Change in the Era of Big Data?
 
Itqb talkslideshfd deritemplate
Itqb talkslideshfd deritemplateItqb talkslideshfd deritemplate
Itqb talkslideshfd deritemplate
 
Evolution 2013: Prof. Dr. Georges De Moor, EuroRec on Liberating Health Data ...
Evolution 2013: Prof. Dr. Georges De Moor, EuroRec on Liberating Health Data ...Evolution 2013: Prof. Dr. Georges De Moor, EuroRec on Liberating Health Data ...
Evolution 2013: Prof. Dr. Georges De Moor, EuroRec on Liberating Health Data ...
 
Use of data
Use of dataUse of data
Use of data
 
Semantics for Bioinformatics: What, Why and How of Search, Integration and An...
Semantics for Bioinformatics: What, Why and How of Search, Integration and An...Semantics for Bioinformatics: What, Why and How of Search, Integration and An...
Semantics for Bioinformatics: What, Why and How of Search, Integration and An...
 
Basic of bioinformatics
Basic of bioinformaticsBasic of bioinformatics
Basic of bioinformatics
 
2011-10-11 Open PHACTS at BioIT World Europe
2011-10-11 Open PHACTS at BioIT World Europe2011-10-11 Open PHACTS at BioIT World Europe
2011-10-11 Open PHACTS at BioIT World Europe
 
Online Resources to Support Open Drug Discovery Systems
Online Resources to Support Open Drug Discovery SystemsOnline Resources to Support Open Drug Discovery Systems
Online Resources to Support Open Drug Discovery Systems
 
Biocuration activities for the International Cancer Genome Consortium (ICGC).
Biocuration activities for the International Cancer Genome Consortium (ICGC).Biocuration activities for the International Cancer Genome Consortium (ICGC).
Biocuration activities for the International Cancer Genome Consortium (ICGC).
 
Conference-The-future-will-be-digital-and-biology-but who-will-lead-watson-go...
Conference-The-future-will-be-digital-and-biology-but who-will-lead-watson-go...Conference-The-future-will-be-digital-and-biology-but who-will-lead-watson-go...
Conference-The-future-will-be-digital-and-biology-but who-will-lead-watson-go...
 
Bioinformatics in the Clinical Pipeline: Contribution in Genomic Medicine
Bioinformatics in the Clinical Pipeline: Contribution in Genomic MedicineBioinformatics in the Clinical Pipeline: Contribution in Genomic Medicine
Bioinformatics in the Clinical Pipeline: Contribution in Genomic Medicine
 
dkNET Webinar: Unlocking the Power of FAIR Data Sharing with ImmPort 04/12/2024
dkNET Webinar: Unlocking the Power of FAIR Data Sharing with ImmPort 04/12/2024dkNET Webinar: Unlocking the Power of FAIR Data Sharing with ImmPort 04/12/2024
dkNET Webinar: Unlocking the Power of FAIR Data Sharing with ImmPort 04/12/2024
 
Mining Phenotypes: How to set up a reverse genetics experiment with an Arabid...
Mining Phenotypes: How to set up a reverse genetics experiment with an Arabid...Mining Phenotypes: How to set up a reverse genetics experiment with an Arabid...
Mining Phenotypes: How to set up a reverse genetics experiment with an Arabid...
 
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
 
A Cell-Cycle Knowledge Integration Framework
A Cell-Cycle Knowledge Integration FrameworkA Cell-Cycle Knowledge Integration Framework
A Cell-Cycle Knowledge Integration Framework
 
Bda2015 tutorial-part1-intro
Bda2015 tutorial-part1-introBda2015 tutorial-part1-intro
Bda2015 tutorial-part1-intro
 
Data analysis & integration challenges in genomics
Data analysis & integration challenges in genomicsData analysis & integration challenges in genomics
Data analysis & integration challenges in genomics
 
Ben Goertzel AIs, Superflies and the Path to Immortality - singsum au 2011
Ben Goertzel AIs, Superflies and the Path to Immortality - singsum au 2011Ben Goertzel AIs, Superflies and the Path to Immortality - singsum au 2011
Ben Goertzel AIs, Superflies and the Path to Immortality - singsum au 2011
 

Mais de Barry Smith

The Division of Deontic Labor
The Division of Deontic LaborThe Division of Deontic Labor
The Division of Deontic Labor
Barry Smith
 
e‐Human Beings: The contribution of internet ranking systems to the developme...
e‐Human Beings: The contribution of internet ranking systems to the developme...e‐Human Beings: The contribution of internet ranking systems to the developme...
e‐Human Beings: The contribution of internet ranking systems to the developme...
Barry Smith
 
Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)
Barry Smith
 

Mais de Barry Smith (20)

Towards an Ontology of Philosophy
Towards an Ontology of PhilosophyTowards an Ontology of Philosophy
Towards an Ontology of Philosophy
 
An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...
 
Ways of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the EruvWays of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the Eruv
 
The Division of Deontic Labor
The Division of Deontic LaborThe Division of Deontic Labor
The Division of Deontic Labor
 
Ontology of Aging (August 2014)
Ontology of Aging (August 2014)Ontology of Aging (August 2014)
Ontology of Aging (August 2014)
 
Meaningful Use
Meaningful UseMeaningful Use
Meaningful Use
 
The Fifth Cycle of Philosophy
The Fifth Cycle of PhilosophyThe Fifth Cycle of Philosophy
The Fifth Cycle of Philosophy
 
Ontology of Poker
Ontology of PokerOntology of Poker
Ontology of Poker
 
Enhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort DataEnhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort Data
 
The Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the HumanitiesThe Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the Humanities
 
IAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence DomainIAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
 
Science of Emerging Social Media
Science of Emerging Social MediaScience of Emerging Social Media
Science of Emerging Social Media
 
Ethics, Informatics and Obamacare
Ethics, Informatics and ObamacareEthics, Informatics and Obamacare
Ethics, Informatics and Obamacare
 
e‐Human Beings: The contribution of internet ranking systems to the developme...
e‐Human Beings: The contribution of internet ranking systems to the developme...e‐Human Beings: The contribution of internet ranking systems to the developme...
e‐Human Beings: The contribution of internet ranking systems to the developme...
 
Ontology of aging and death
Ontology of aging and deathOntology of aging and death
Ontology of aging and death
 
Ontology in-buffalo-2013
Ontology in-buffalo-2013Ontology in-buffalo-2013
Ontology in-buffalo-2013
 
ImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial dataImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial data
 
Ontology of Documents (2005)
Ontology of Documents (2005)Ontology of Documents (2005)
Ontology of Documents (2005)
 
Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)
 
Introduction to the Logic of Definitions
Introduction to the Logic of DefinitionsIntroduction to the Logic of Definitions
Introduction to the Logic of Definitions
 

Último

1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdf
QucHHunhnh
 
Beyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global ImpactBeyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global Impact
PECB
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
QucHHunhnh
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
kauryashika82
 
An Overview of Mutual Funds Bcom Project.pdf
An Overview of Mutual Funds Bcom Project.pdfAn Overview of Mutual Funds Bcom Project.pdf
An Overview of Mutual Funds Bcom Project.pdf
SanaAli374401
 

Último (20)

Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17  How to Extend Models Using Mixin ClassesMixin Classes in Odoo 17  How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
 
1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdf
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
 
Beyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global ImpactBeyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global Impact
 
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptxSOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
SOCIAL AND HISTORICAL CONTEXT - LFTVD.pptx
 
This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.
 
ICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptx
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
 
Application orientated numerical on hev.ppt
Application orientated numerical on hev.pptApplication orientated numerical on hev.ppt
Application orientated numerical on hev.ppt
 
Código Creativo y Arte de Software | Unidad 1
Código Creativo y Arte de Software | Unidad 1Código Creativo y Arte de Software | Unidad 1
Código Creativo y Arte de Software | Unidad 1
 
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptxINDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
INDIA QUIZ 2024 RLAC DELHI UNIVERSITY.pptx
 
Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...
Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...
Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introduction
 
An Overview of Mutual Funds Bcom Project.pdf
An Overview of Mutual Funds Bcom Project.pdfAn Overview of Mutual Funds Bcom Project.pdf
An Overview of Mutual Funds Bcom Project.pdf
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdf
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17
 
APM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across SectorsAPM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across Sectors
 
Web & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdfWeb & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdf
 
Z Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot GraphZ Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot Graph
 

Ontology for the Financial Services Industry

  • 1. Reference Data Integration: A Strategy For The Future Barry Smith National Center for Ontological Research University at Buffalo presented at FIMA, March 21, 2012 1
  • 2. Who am I? National Center for Biomedical Ontology based in Stanford Medical School, the Mayo Clinic and Buffalo Department of Philosophy 2 • Cleveland Clinic Semantic Database • Duke University Health System • University of Pittsburgh Medical Center • German Federal Ministry of Health • European Union eHealth Directorate • Plant Genome Research Resource • Protein Information Resource
  • 3. Who am I? National Center for Ontological Research (http://ncor.us) • Joint Warfighting Center, US Joint Forces Command • Intelligence and Information Warfare Directorate (I2WD) • US Department of the Army Net-Centric Data Strategy Center of Excellence • NextGen (Next Generation Air Transportation System) Ontology Team • National Nuclear Security Administration (NNSA), Department of Energy 3
  • 4. Some questions • How to find data? • How to understand data when you find it? • How to use data when you find it? • How to compare and integrate with other data? • How to avoid data silos? 4
  • 5. The Web (net-centricity) as part of the solution • You build a site • Others discover the site and they link to it • The more they link, the more well known the page becomes (Google …) • Your data becomes discoverable 5
  • 6. 1. Make your data available in a standard way on the Web 2. Use controlled vocabularies (‘ontologies’) to capture common meanings, in ways understandable to both humans and computers – Web Ontology Language (OWL) 3. Build links among the datasets to create a ‘web of data’ The roots of Semantic Technology
  • 7. Controlled vocabularies for tagging (‘annotating’) data • Hardware changes rapidly • Organizations rapidly forming and disbanding • Data is exploding • Meanings of common words change slowly • Use web architecture to annotate exploding data stores using ontologies to capture these common meanings in a stable way 7
  • 8. Where we stand today • increasing availability of semantically enhanced data and semantic software • increasing use of XML, RDF, OWL in attempts to create useful integration of on-line data and information • “Linked Open Data” the New Big Thing 8
  • 9. Ontology success stories, and some reasons for failure • 9
  • 11. The problem: the more Semantic Technology is successful, they more it fails The original idea was to break down silos via common controlled vocabularies for the tagging of data The very success of the approach leads to the creation of ever new controlled vocabularies – semantic silos – as ever more ontologies are created in ad hoc ways The Semantic Web framework as currently conceived and governed by the W3C yields minimal standardization Multiplying (Meta)data registries are creating data cemeteries 11
  • 12. NCBO Bioportal (Ontology Registry) 12
  • 13. 13/24
  • 14. 14/24
  • 15. Reasons for this effect • Low incentives for reuse of existing ontologies • Each organization wants its own ontology • Poor licensing regime, poor standards, poor training • People think: Information technology (hardware) is changing constantly, so it’s not worth the effort of getting things right • People have egos: “We have done it this way for 30 years, we are not going to change now” 15
  • 16. Why should you care? • when they are many ad hoc systems, average quality will be low • constant need for ad hoc repair through manual effort • DoD alone spends $6 billion per annum on this problem • regulatory agencies are recognizing the need for common controlled vocabularies 16/24
  • 17. So now people are scrambling • to learn how to create ontologies • serious lag in creating trained expertise • poor quality coding leads to poor quality ontologies • poor quality ontology management 17
  • 18. How to do it right? • how create an incremental, evolutionary process, where what is good survives ? • how to bring about ontology death ? A success story from biology 18
  • 21. 0 200 400 600 800 1000 1200 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 AxisTitle Series 1 Ontology in PubMed
  • 22. By far the most successful: GO (Gene Ontology) 22
  • 23. 23 what cellular component? what molecular function? what biological process? the Gene Ontology is not an ontology of ge
  • 24. arson lw n3d ... t_LW_n3 d_5p_... Colored by: Copy of Copy of C5_RMA (Defa... Gene List: all genes (1 4010) attacked time control Puparial adhesion Molting cycle hemocyanin Defense response Immune response Response to stimulus Toll regulated genes JAK-STAT regulated genes Immune response Toll regulated genes Amino acid catabolism Lipid metobolism Peptidase activity Protein catabloism Immune response e Tree: pearson lw n3d ... lassification: Set_LW_n3d_5p_... Colored by: Copy of Copy of C5_RMA (Defa... Gene List: all genes (14010) Microarray data shows changed expression of thousands of genes. How will you spot the patterns? 24
  • 25. Why is GO successful • built by bench biologists • multi-species, multi-disciplinary, open source • compare use of kilograms, meters, seconds in formulating experimental results • natural language and logical definitions for all terms • initially low-tech to ensure aggressive use and testing 25
  • 26. now used not just in biology but also in hospital research 26
  • 27. Lab / pathology data EHR data Clinical trial data Family history data Medical imaging Microarray data Model organism data Flow cytometry Mass spec Genotype / SNP data How will you spot the patterns? How will you find the data you need? 27
  • 28.  over 11 million annotations relating UniProt, Ensembl and other databases to terms in the GO 28
  • 29. 29 Hierarchical view representing relations between represented types
  • 30. ~ $200 mill. invested in the GO so far A new kind of biomedical research Over 11 million GO annotations to biomedical research literature freely available on the web Powerful software tool support for navigating this data means that what used to take researchers months of data comparison effort, can now be performed in milliseconds 30
  • 31. If controlled vocabularies are to serve to remove silos they have to be respected by many owners of data as resources that ensure accurate description of their data – GO maintained not by computer scientists but by biologists they have to be willingly used in annotations by many owners of data they have to be maintained by persons who are trained in common principles of ontology maintenance 31
  • 32. 32 The new profession of biocurator
  • 33. GO has been amazingly successful Has created a community consensus Has created a web of feedback loops where users of the GO can easily report errors and gaps Has identified principles for successful ontology management Indispensable to every drug company and every biology lab 33
  • 34. But GO is limited in its scope it covers only generic biological entities of three sorts: –cellular components –molecular functions –biological processes no diseases, symptoms, disease biomarkers, protein interactions, experimental processes … 34
  • 35. Extending the GO methodology to other domains of biology and medicine 35
  • 36. RELATION TO TIME GRANULARITY CONTINUANT OCCURRENT INDEPENDENT DEPENDENT ORGAN AND ORGANISM Organism (NCBI Taxonomy) Anatomical Entity (FMA, CARO) Organ Function (FMP, CPRO) Phenotypic Quality (PaTO) Biological Process (GO) CELL AND CELLULAR COMPONENT Cell (CL) Cellular Component (FMA, GO) Cellular Function (GO) MOLECULE Molecule (ChEBI, SO, RnaO, PrO) Molecular Function (GO) Molecular Process (GO) OBO (Open Biomedical Ontology) Foundry proposal (Gene Ontology in yellow) 36
  • 37. RELATION TO TIME GRANULARITY CONTINUANT OCCURRENT INDEPENDENT DEPENDENT ORGAN AND ORGANISM Organism (NCBI Taxonomy) Anatomical Entity (FMA, CARO) Organ Function (FMP, CPRO) Phenotypic Quality (PaTO) Biological Process (GO) CELL AND CELLULAR COMPONENT Cell (CL) Cellular Component (FMA, GO) Cellular Function (GO) MOLECULE Molecule (ChEBI, SO, RnaO, PrO) Molecular Function (GO) Molecular Process (GO) The strategy of orthogonal modules 37
  • 38. Ontology Scope URL Custodians Cell Ontology (CL) cell types from prokaryotes to mammals obo.sourceforge.net/cgi- bin/detail.cgi?cell Jonathan Bard, Michael Ashburner, Oliver Hofman Chemical Entities of Bio- logical Interest (ChEBI) molecular entities ebi.ac.uk/chebi Paula Dematos, Rafael Alcantara Common Anatomy Refer- ence Ontology (CARO) anatomical structures in human and model organisms (under development) Melissa Haendel, Terry Hayamizu, Cornelius Rosse, David Sutherland, Foundational Model of Anatomy (FMA) structure of the human body fma.biostr.washington. edu JLV Mejino Jr., Cornelius Rosse Functional Genomics Investigation Ontology (FuGO) design, protocol, data instrumentation, and analysis fugo.sf.net FuGO Working Group Gene Ontology (GO) cellular components, molecular functions, biological processes www.geneontology.org Gene Ontology Consortium Phenotypic Quality Ontology (PaTO) qualities of anatomical structures obo.sourceforge.net/cgi -bin/ detail.cgi? attribute_and_value Michael Ashburner, Suzanna Lewis, Georgios Gkoutos Protein Ontology (PrO) protein types and modifications (under development) Protein Ontology Consortium Relation Ontology (RO) relations obo.sf.net/relationship Barry Smith, Chris Mungall RNA Ontology (RnaO) three-dimensional RNA structures (under development) RNA Ontology Consortium Sequence Ontology (SO) properties and features of nucleic sequences song.sf.net Karen Eilbeck
  • 39. How to recreate the success of the GO in other areas 1. create a portal for sharing of information about existing controlled vocabularies, needs and institutions operating in a given area 2. create a library of ontologies in this area 3. create a consortium of developers of these ontologies who agree to pool their efforts to create a single set of non-overlapping ontology modules – one ontology for each sub-area 39
  • 40. 40 NextGen Ontology Portal Portal CommunitiesSearch Ontology Library NextGen Enterprise Ontology Ontology Portal • Two-Tiered Registry – NextGen Ontology – consist of vetted ontologies – Ontology Library – open to the wider community • Ontology Metadata – Ontology owner, domain, and location • Ontology Search* – Support ontology discovery
  • 41.  Developers commit in advance to collaborating with developers of ontologies in adjacent domains and  to working to ensure that, for each domain, there is community convergence on a single ontology http://obofoundry.org The OBO Foundry: a step-by- step, principles-based approach 41
  • 42. OBO Foundry Principles  Common governance  Common training  Robust versioning  Common architecture 42
  • 43. Anatomy Ontology (FMA*, CARO) Environment Ontology (EnvO) Infectious Disease Ontology (IDO*) Biological Process Ontology (GO*) Cell Ontology (CL) Cellular Component Ontology (FMA*, GO*) Phenotypic Quality Ontology (PaTO) Subcellular Anatomy Ontology (SAO) Sequence Ontology (SO*) Molecular Function (GO*)Protein Ontology (PRO*) OBO Foundry Modular Organization top level mid-level domain level Information Artifact Ontology (IAO) Ontology for Biomedical Investigations (OBI) Ontology of General Medical Science (OGMS) Basic Formal Ontology (BFO) 43
  • 44. UCore 2.0 / UCore SL Extension Strategy 44 top level mid-level domain level Military domain ontologies as extensions of the Universal Core Semantic Layer
  • 45. Existing efforts to create modular ontology suites NASA Sweet Ontologies Military Intelligence Ontology Foundry Planned OMG efforts: • OMG (CIA) Financial Event Ontology • Semantic Layer for ISO 20022 (Financial Industry Message Scheme)
  • 47.
  • 48. Basic principles of ontology development – for formulating definitions – of modularity – of user feedback for error correction and gap identification – for ensuring compatibility between modules – for using ontologies to annotate legacy data – for using ontologies to create new data – for developing user-specific views
  • 49. Modularity designed to ensure • non-redundancy • annotations can be additive • division of labor among SMEs • lessons learned in one module can benefit work on other modules • transferrable training • motivation of SME users 49
  • 50. How the FIMA Reference Data community should solve this problem? Major financial institutions Major software vendors Major data management companies EDMC and government principals – should pool information about the controlled vocabularies which already exist – create a common library of these controlled vocabularies – create a subset of thought leaders who agree to pool their efforts in the creation of a suite of ontology modules for common use – create a strategy to disseminate and evolve the selected modules – create a governance strategy to manage the modules over time – allow bad ontologies to die
  • 51. Urgent need for trained ontologists Severe shortage of persons with the needed expertise University at Buffalo Online Training and Certification Program for Ontologists for details: phismith@buffalo.edu

Notas do Editor

  1. http://www.w3.org/People/Ivan/CorePresentations/HighLevelIntro/
  2. http://www.w3.org/People/Ivan/CorePresentations/HighLevelIntro/
  3. http://www.w3.org/People/Ivan/CorePresentations/HighLevelIntro/
  4. Ivan Herman
  5. http://dbpedia.org/fct/images/lod-datasets_2009-03-27_colored.png
  6. http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=116006492sequence of X chromosome in baker’s yeast
  7. http://1105govinfoevents.com/EA/Presentations/EA09_2-2_Robinson.pdf