SlideShare uma empresa Scribd logo
1 de 37
Comparison of Compound-to-Target
Relationships in Chemogenomic and
          Drug Databases
Aprill 2012 update: FYI these two blog posts are on the same theme
   http://cdsouthan.blogspot.se/2012/01/our-human-beta-lactamase-is-not_09.html

   http://cdsouthan.blogspot.se/2011/08/compound-to-target-mappings-part-i.html


                           Chris Southan
                ChrisDS Consulting, Göteborg, Sweden,

         Presented to the NCBI PubChem team on 11 April. the BioIT World
   Chemogenomics and Toxicogenomics Workshop on 12 April Boston, USA, and
      as a shorter version, the ChEMBL users meeting at the EBI, 27 may 2011



                                                                                  [1]
Aknowledgments and Context

• I profoundly appreciate the efforts of those who develop, manage
  and maintain public resources specified here and many others I
  enjoy acessing

• I have some history in evaluating the utility, exploitation and
  content quality of both bioinformatics and cheminformatics
  databases. I thus enjoy the dual roles (roughly in equal parts) of
  both fan and critic

• All databases have imperfections. This presentation investigates a
  selection of these but critical analysis should not be missinterpreted
  as disparaging either the quality of primary sources or the work of
  curators and database teams




                                                                           [2]
Outline


•   Mapping concepts sources and challenges
•   Extremes of the distribution
•   Atorvastatin, drug-to-targets
•   Hmg-CoA reductase target-to-drugs
•   Equivocal mapping examples
•   Exploring data intersects
•   Complex targets
•   Conclusions and outlook




                                              [3]
Activity-to-compound-to-protein Mapping:
   Capturing Relationships Between four Concepts

                                                    MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGG
                                                    APLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQ
                                                    GYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHR
                                                    YYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSI
                                                    PHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEI
                                                    ARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSE
                                                    VLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIV
                                                    RVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFE
                                                    AAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNI
                                                    FPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDD
                                                    CYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAV
                                                    SACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTL
                                                    MTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQHD
                                                    DFADDISLLK




Document      Assay       Result     Compound          Protein

               Expert extraction and curation

Unstructured data                          Structured data

Papers & Patents                                Databases
                                                                                       [4]
The D-A-R-C-P Axis




                     Pathway/module/
                     system




                                   [5]
Compound and drug-to-target Collations
                                            D-A-R-C-P
 Targets = 5,662 protein targets, cpds = 284,206 data points = 648,915,
                                             D-A-R-C-P

  Targets = 8,091 Small Molecules = 658,075, data points = 3,030,317
                                           (D)-A-R-C-P-S

BioAssays extracted from literature (ChEMBL) = 499,520, Direct screening
     assays = 3,208, active Compounds = 23,677, Targets = 447
                                             D-C-P-S
                Approved cpds = 1431 , Targets = 1458,
          Experimental cpds = 5212, research targets = 3206
                                               D-C-P

     Targets = 358 successful, 251 clinical trial and 1,254 research,
   Drugs = 1,511 approved, 1,118 clinical trial and 2,331 experimental
                                                                           [6]
PDB
  Drug-to-
  Protein
 Mappings
in DrugPort




          [7]
Target Mapping: Curatorial Challenges
•   Target = (infered) direct binding
•   Primary (bona fide) target = therapeutic causality
•   Polytargets = multiple
•   Para-target = sub-family specificity
•   Ortho-target = cross-species specificity
•   Cross-screen = non-homologous
•   Non-target (e.g. trypsin, albumin)
•   Off-target = liability (ADR or side effect)
•   Anti-target = known libaility (e.g. HERG)
•   Indirect target = non-binding (e.g. APP)
•   Complex = resolvable to sequence IDs (eg proteosome)
•   Complex = experimentaly unresolved (e.g. PDE5s)
•   Ambigous = lack of metadata or curatorial judgment (e.g. BACE)
•   Non-canonical = where metadata specifies mutation, splice or PTM
•   Metabo-target = metabolic interactions
•   Transport-target = transporters
                                                                       [8]
Drug-target Networks




                       [9]
One target-to-many compounds:
    Dopamine Receptor D2




                            [10]
One compound-to-(367)-
       proteins




                         [11]
Mapping sources for
the top selling drug




                       [12]
Target Matrix for Atorvastatin
    Swiss-Prot    ChEMBL     TTD   DrugBa   PubChem
                 (BindingD           nk
                     B)
    HMDH_HUMAN      X        X       X      (PDB) X
    HMDH_RAT        X                          X
    DPP4_HUMAN                       X
    DPP4_PIG        X
    AHR_HUMAN                        X




                                                      [13]
Other
 Statins:

 Different
 BioAssay
Coverages




             [14]
Diferent PubChem CIDs map to different
submissions, structures and activity profiles
         Atorvastatin -> 10 CID name matches

                                     Substances 397 Links
                                     Same structure: 33 Links
                                      Mixture: 364 Links
                                     CID 60823 39 canonical




                                     Substances: 19 Links




                                                            [15]
Vice-versa, Compounds-to-target: HMG-CoA




                                           [16]
Drugs mapped to HMG-CoA as target




Swiss-Prot cross-reference




                                             [17]
Equivocal Mappings




                     [18]
Swiss-Prot Target Intersects




• 1,627 results for database:(type:drugbank)
• 297 results for database:(type:bindingdb)
• 45 results for database:(type:bindingdb) AND
  database:(type:drugbank) AND organism:"Homo sapiens

                                                        [19]
Mixed
Mappings




           [20]
Mannitol: drug ? yes -
ligand ? yes ? target ? no




                             [21]
Polypropylene Glycol: drug ? no, ligand ?
           maybe, target ? no




                                            [22]
E-2012: False-negative?




                          [23]
Antifreeze: drug ?, no, ligand ? no,
         154 targets ? no


                        Wikipedia: Ethylene glycol is
                        moderately toxic with an oral
                        LDLO = 786 mg/kg for
                        humans




                                                        [24]
Crowdsourcing Works !




                        [25]
Curation Challenges




                      [26]
Secretase matches
      in TTD


Mixed-concept targets
but no small-molecule
    true positives




                    [27]
Gamma Secretase Activity: Variable Subunit
              Mappings




                                             [28]
APP: Indirect Target, three mechanisms



      “for small molecules that suppress the Amyloid Precursor Protein (APP)
      translation by binding to the 5'Untranslated Region of the APP mRNA




                                                                               [29]
Proteasome: Target Descriptions and Cross-
         screens for Bortzemib




                                             [30]
PubChem Compound Intersects:
Primary Drug Targets with Screening data




                                       [31]
Mycophenolic acid




                    [32]
Mycophenolic acid and Prodrug: Complex mappings
  • Primary Target human IMPDH2

  • IMPDH1 ?

  • IMPDH2 hamster



  • IMPDH2 Tritrichomonas

  • myfortic is an enteric-coated formulation of MPA in a delayed-
    release tablet.




                                                                     [33]
Conclusions



• Compared to what we had even a few years ago, let alone in
  LBPC (life-before-PubChem) these compound-to-protein
  sources are fantastic
• However, most things that could go wrong have
• We don’t often see QC statistics
• Data coverage is patchy, ad hoc and can be circular
• If you operate on these data at large scale you have no choice
  but to ”trust and filter”
• If detailed realationships are important you need to ”verify and
  judge” back to the primary source
• You can only really do this if you have at least some in vitro
  background rather than just in silico




                                                                     [34]
Wouldn’t it be nice if we had ....


• Interpreted mapping distribution statisitcs for each database
• Details about extraction triages, curation rules and parsing logic
• Harmonisation of mapping rules and cross-comparison of content
• Clear declarations and statistics of circularity between databases
• Curator judgments overuling document primacy
• Consolidated and extended Swiss-Prot cross-references
• Assay and target ontologies (Pistoia ? Open Phacts ?)
• “Standardization of Enzyme Data” (STRENDA, http://www.beilstein-
  institut.de/en/projekte/strenda/)
• “Minimum Information About a Bioactive Entity” (MIABE,
  http://www.psidev.info/index.php?q=node/394)




                                                                       [35]
Our Efforts




http://www.jcheminf.com/content/3/1/14




http://www.jcheminf.com/content/1/1/10
                                         [36]
[37]

Mais conteúdo relacionado

Mais procurados

Predicting Value of Binding Constants of Organic Ligands to Beta-Cyclodextrin...
Predicting Value of Binding Constants of Organic Ligands to Beta-Cyclodextrin...Predicting Value of Binding Constants of Organic Ligands to Beta-Cyclodextrin...
Predicting Value of Binding Constants of Organic Ligands to Beta-Cyclodextrin...
Maciej Przybyłek
 
1 -val_gillet_-_ligand-based_and_structure-based_virtual_screening
1  -val_gillet_-_ligand-based_and_structure-based_virtual_screening1  -val_gillet_-_ligand-based_and_structure-based_virtual_screening
1 -val_gillet_-_ligand-based_and_structure-based_virtual_screening
Deependra Ban
 

Mais procurados (12)

Cibb2013
Cibb2013Cibb2013
Cibb2013
 
E0362430
E0362430E0362430
E0362430
 
Vls
VlsVls
Vls
 
Computer Assisted Drug Design By Rauf Pathan and Patel Mo Shaffan
Computer Assisted Drug Design By Rauf Pathan and Patel Mo ShaffanComputer Assisted Drug Design By Rauf Pathan and Patel Mo Shaffan
Computer Assisted Drug Design By Rauf Pathan and Patel Mo Shaffan
 
Comparison between Oral Delivery of Eudragit RSPO Microsphere-Based Matrix Ta...
Comparison between Oral Delivery of Eudragit RSPO Microsphere-Based Matrix Ta...Comparison between Oral Delivery of Eudragit RSPO Microsphere-Based Matrix Ta...
Comparison between Oral Delivery of Eudragit RSPO Microsphere-Based Matrix Ta...
 
Molecular docking and its importance in drug design
Molecular docking and its importance in drug designMolecular docking and its importance in drug design
Molecular docking and its importance in drug design
 
Combining Syntactic Information and domain-specific Lexical Patterns to Extra...
Combining Syntactic Information and domain-specific Lexical Patterns to Extra...Combining Syntactic Information and domain-specific Lexical Patterns to Extra...
Combining Syntactic Information and domain-specific Lexical Patterns to Extra...
 
Predicting Value of Binding Constants of Organic Ligands to Beta-Cyclodextrin...
Predicting Value of Binding Constants of Organic Ligands to Beta-Cyclodextrin...Predicting Value of Binding Constants of Organic Ligands to Beta-Cyclodextrin...
Predicting Value of Binding Constants of Organic Ligands to Beta-Cyclodextrin...
 
1 -val_gillet_-_ligand-based_and_structure-based_virtual_screening
1  -val_gillet_-_ligand-based_and_structure-based_virtual_screening1  -val_gillet_-_ligand-based_and_structure-based_virtual_screening
1 -val_gillet_-_ligand-based_and_structure-based_virtual_screening
 
Computer aided drug design(CADD)
Computer aided drug design(CADD)Computer aided drug design(CADD)
Computer aided drug design(CADD)
 
Computer Aided Drug Design
Computer Aided Drug DesignComputer Aided Drug Design
Computer Aided Drug Design
 
Computer Aided Drug Design ppt
Computer Aided Drug Design pptComputer Aided Drug Design ppt
Computer Aided Drug Design ppt
 

Destaque

Will the real drug targets please stand up ?
Will the real drug targets please stand up ? Will the real drug targets please stand up ?
Will the real drug targets please stand up ?
Chris Southan
 

Destaque (6)

Exploring SAR between Patents and PubChem
Exploring SAR between Patents and PubChemExploring SAR between Patents and PubChem
Exploring SAR between Patents and PubChem
 
Open Acess Sources for Protein Interaction Inhibitors
Open Acess Sources for Protein Interaction InhibitorsOpen Acess Sources for Protein Interaction Inhibitors
Open Acess Sources for Protein Interaction Inhibitors
 
Chemistry-to-Protein Relastionship Quality
Chemistry-to-Protein Relastionship QualityChemistry-to-Protein Relastionship Quality
Chemistry-to-Protein Relastionship Quality
 
Will the real drug targets please stand up ?
Will the real drug targets please stand up ? Will the real drug targets please stand up ?
Will the real drug targets please stand up ?
 
Which Drug Did You Mean ?
Which Drug Did You Mean ?Which Drug Did You Mean ?
Which Drug Did You Mean ?
 
ELIXIR Database Provider Survey
ELIXIR Database Provider SurveyELIXIR Database Provider Survey
ELIXIR Database Provider Survey
 

Semelhante a Comparison of Compounds-to-targets between Databases

Analysing the drug targets in the human genome
Analysing the drug targets in the human genomeAnalysing the drug targets in the human genome
Analysing the drug targets in the human genome
Guide to PHARMACOLOGY
 
Presentationretrrgdgxxdbhhggvfcddxx.pptx
Presentationretrrgdgxxdbhhggvfcddxx.pptxPresentationretrrgdgxxdbhhggvfcddxx.pptx
Presentationretrrgdgxxdbhhggvfcddxx.pptx
taoufikakabli1
 

Semelhante a Comparison of Compounds-to-targets between Databases (20)

Digging out Structures for Repurposing: Non-competitive Intelligence ...
Digging out Structures for Repurposing: Non-competitive Intelligence        ...Digging out Structures for Repurposing: Non-competitive Intelligence        ...
Digging out Structures for Repurposing: Non-competitive Intelligence ...
 
IUPHAR/BPS Guide to Pharmacology: concise mapping of chemistry, data, and tar...
IUPHAR/BPS Guide to Pharmacology: concise mapping of chemistry, data, and tar...IUPHAR/BPS Guide to Pharmacology: concise mapping of chemistry, data, and tar...
IUPHAR/BPS Guide to Pharmacology: concise mapping of chemistry, data, and tar...
 
Mining Drug Targets, Structures and Activity Data
Mining Drug Targets, Structures and Activity DataMining Drug Targets, Structures and Activity Data
Mining Drug Targets, Structures and Activity Data
 
Synthesis, characterization and molecular docking of sulphacetamide
Synthesis, characterization and molecular docking of sulphacetamideSynthesis, characterization and molecular docking of sulphacetamide
Synthesis, characterization and molecular docking of sulphacetamide
 
Pharmacophore mapping in Drug Development
Pharmacophore mapping in Drug DevelopmentPharmacophore mapping in Drug Development
Pharmacophore mapping in Drug Development
 
BioExpo 2023 Presentation - Computational Chemistry in Drug Discovery: Bridgi...
BioExpo 2023 Presentation - Computational Chemistry in Drug Discovery: Bridgi...BioExpo 2023 Presentation - Computational Chemistry in Drug Discovery: Bridgi...
BioExpo 2023 Presentation - Computational Chemistry in Drug Discovery: Bridgi...
 
Analysing the drug targets in the human genome
Analysing the drug targets in the human genomeAnalysing the drug targets in the human genome
Analysing the drug targets in the human genome
 
Evolving consensus-based curatorial strategies
Evolving consensus-based curatorial strategiesEvolving consensus-based curatorial strategies
Evolving consensus-based curatorial strategies
 
The IUPHAR/MMV Guide to Malaria Pharmacology
The  IUPHAR/MMV Guide to Malaria Pharmacology  The  IUPHAR/MMV Guide to Malaria Pharmacology
The IUPHAR/MMV Guide to Malaria Pharmacology
 
Slicing and dicing expert-curated protein targets in the Guide to PHARMACOLGY
Slicing and dicing expert-curated protein targets in the Guide to PHARMACOLGYSlicing and dicing expert-curated protein targets in the Guide to PHARMACOLGY
Slicing and dicing expert-curated protein targets in the Guide to PHARMACOLGY
 
Presentationretrrgdgxxdbhhggvfcddxx.pptx
Presentationretrrgdgxxdbhhggvfcddxx.pptxPresentationretrrgdgxxdbhhggvfcddxx.pptx
Presentationretrrgdgxxdbhhggvfcddxx.pptx
 
Drug-to-protein mappings in the Guide to PHARMACOLOGY: Utility as a target va...
Drug-to-protein mappings in the Guide to PHARMACOLOGY: Utility as a target va...Drug-to-protein mappings in the Guide to PHARMACOLOGY: Utility as a target va...
Drug-to-protein mappings in the Guide to PHARMACOLOGY: Utility as a target va...
 
Significance of computational tools in drug discovery
Significance of computational tools in drug discoverySignificance of computational tools in drug discovery
Significance of computational tools in drug discovery
 
Cadd and molecular modeling for M.Pharm
Cadd and molecular modeling for M.PharmCadd and molecular modeling for M.Pharm
Cadd and molecular modeling for M.Pharm
 
BCSRCv1.3
BCSRCv1.3BCSRCv1.3
BCSRCv1.3
 
Open Phenotypic Drug Discovery Resource poster
Open Phenotypic Drug Discovery Resource posterOpen Phenotypic Drug Discovery Resource poster
Open Phenotypic Drug Discovery Resource poster
 
Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013
Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013
Bioinformatics t9-t10-bio cheminformatics-wimvancriekinge_v2013
 
2016 bioinformatics i_bio_cheminformatics_wimvancriekinge
2016 bioinformatics i_bio_cheminformatics_wimvancriekinge2016 bioinformatics i_bio_cheminformatics_wimvancriekinge
2016 bioinformatics i_bio_cheminformatics_wimvancriekinge
 
Druggable genome in GtoPdb and other dbs
Druggable genome in GtoPdb and other dbsDruggable genome in GtoPdb and other dbs
Druggable genome in GtoPdb and other dbs
 
2015 bioinformatics bio_cheminformatics_wim_vancriekinge
2015 bioinformatics bio_cheminformatics_wim_vancriekinge2015 bioinformatics bio_cheminformatics_wim_vancriekinge
2015 bioinformatics bio_cheminformatics_wim_vancriekinge
 

Mais de Chris Southan

Vicissitudes of target validation for BACE1 and BACE2
Vicissitudes of target validation for BACE1 and BACE2 Vicissitudes of target validation for BACE1 and BACE2
Vicissitudes of target validation for BACE1 and BACE2
Chris Southan
 
In silico 360 Analysis for Drug Development
In silico 360 Analysis for Drug DevelopmentIn silico 360 Analysis for Drug Development
In silico 360 Analysis for Drug Development
Chris Southan
 

Mais de Chris Southan (20)

FAIR connectivity for DARCP
FAIR  connectivity for DARCPFAIR  connectivity for DARCP
FAIR connectivity for DARCP
 
Connectivity > documents > structures > bioactivity
Connectivity > documents > structures > bioactivityConnectivity > documents > structures > bioactivity
Connectivity > documents > structures > bioactivity
 
Peptide tribulations
Peptide tribulationsPeptide tribulations
Peptide tribulations
 
Vicissitudes of target validation for BACE1 and BACE2
Vicissitudes of target validation for BACE1 and BACE2 Vicissitudes of target validation for BACE1 and BACE2
Vicissitudes of target validation for BACE1 and BACE2
 
Guide to Pharmacology database: ELIXIR updae
Guide to Pharmacology database: ELIXIR updaeGuide to Pharmacology database: ELIXIR updae
Guide to Pharmacology database: ELIXIR updae
 
In silico 360 Analysis for Drug Development
In silico 360 Analysis for Drug DevelopmentIn silico 360 Analysis for Drug Development
In silico 360 Analysis for Drug Development
 
Will the correct BACE ORFs please stand up?
Will the correct BACE ORFs please stand up?Will the correct BACE ORFs please stand up?
Will the correct BACE ORFs please stand up?
 
Desperately seeking DARCP
Desperately seeking DARCPDesperately seeking DARCP
Desperately seeking DARCP
 
Seeking glimmers of light in Pharos “Tdark” proteins
Seeking glimmers of light in  Pharos “Tdark” proteinsSeeking glimmers of light in  Pharos “Tdark” proteins
Seeking glimmers of light in Pharos “Tdark” proteins
 
5HT2A modulators update for SAFER
5HT2A modulators update for SAFER5HT2A modulators update for SAFER
5HT2A modulators update for SAFER
 
Quality and noise in big chemistry databases
Quality and noise in big chemistry databasesQuality and noise in big chemistry databases
Quality and noise in big chemistry databases
 
Connecting chemistry-to-biology
Connecting chemistry-to-biology Connecting chemistry-to-biology
Connecting chemistry-to-biology
 
GtoPdb June 2019 poster
GtoPdb June 2019 posterGtoPdb June 2019 poster
GtoPdb June 2019 poster
 
PubChem as a source of systems biology perturbagens
PubChem as a source of  systems biology perturbagensPubChem as a source of  systems biology perturbagens
PubChem as a source of systems biology perturbagens
 
PubChem for drug discovery and chemical biology
PubChem for drug discovery and chemical biologyPubChem for drug discovery and chemical biology
PubChem for drug discovery and chemical biology
 
Will the real proteins please stand up
Will the real proteins please stand upWill the real proteins please stand up
Will the real proteins please stand up
 
Peptide Tribulations
Peptide TribulationsPeptide Tribulations
Peptide Tribulations
 
Looking at chemistry - protein - papers connectivity in ELIXIR
Looking at chemistry - protein - papers connectivity in ELIXIRLooking at chemistry - protein - papers connectivity in ELIXIR
Looking at chemistry - protein - papers connectivity in ELIXIR
 
Guide to Immunopharmacology update
Guide to Immunopharmacology updateGuide to Immunopharmacology update
Guide to Immunopharmacology update
 
Druggable Proteome sources in UniProt
Druggable Proteome sources in UniProtDruggable Proteome sources in UniProt
Druggable Proteome sources in UniProt
 

Último

Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
Sheetaleventcompany
 
💚Call Girls In Amritsar 💯Anvi 📲🔝8725944379🔝Amritsar Call Girl No💰Advance Cash...
💚Call Girls In Amritsar 💯Anvi 📲🔝8725944379🔝Amritsar Call Girl No💰Advance Cash...💚Call Girls In Amritsar 💯Anvi 📲🔝8725944379🔝Amritsar Call Girl No💰Advance Cash...
💚Call Girls In Amritsar 💯Anvi 📲🔝8725944379🔝Amritsar Call Girl No💰Advance Cash...
Sheetaleventcompany
 
💚Chandigarh Call Girls Service 💯Piya 📲🔝8868886958🔝Call Girls In Chandigarh No...
💚Chandigarh Call Girls Service 💯Piya 📲🔝8868886958🔝Call Girls In Chandigarh No...💚Chandigarh Call Girls Service 💯Piya 📲🔝8868886958🔝Call Girls In Chandigarh No...
💚Chandigarh Call Girls Service 💯Piya 📲🔝8868886958🔝Call Girls In Chandigarh No...
Sheetaleventcompany
 
Difference Between Skeletal Smooth and Cardiac Muscles
Difference Between Skeletal Smooth and Cardiac MusclesDifference Between Skeletal Smooth and Cardiac Muscles
Difference Between Skeletal Smooth and Cardiac Muscles
MedicoseAcademics
 
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
Sheetaleventcompany
 
Kolkata Call Girls Service ❤️🍑 9xx000xx09 👄🫦 Independent Escort Service Kolka...
Kolkata Call Girls Service ❤️🍑 9xx000xx09 👄🫦 Independent Escort Service Kolka...Kolkata Call Girls Service ❤️🍑 9xx000xx09 👄🫦 Independent Escort Service Kolka...
Kolkata Call Girls Service ❤️🍑 9xx000xx09 👄🫦 Independent Escort Service Kolka...
Sheetaleventcompany
 

Último (20)

💚Reliable Call Girls Chandigarh 💯Niamh 📲🔝8868886958🔝Call Girl In Chandigarh N...
💚Reliable Call Girls Chandigarh 💯Niamh 📲🔝8868886958🔝Call Girl In Chandigarh N...💚Reliable Call Girls Chandigarh 💯Niamh 📲🔝8868886958🔝Call Girl In Chandigarh N...
💚Reliable Call Girls Chandigarh 💯Niamh 📲🔝8868886958🔝Call Girl In Chandigarh N...
 
❤️Call Girl Service In Chandigarh☎️9814379184☎️ Call Girl in Chandigarh☎️ Cha...
❤️Call Girl Service In Chandigarh☎️9814379184☎️ Call Girl in Chandigarh☎️ Cha...❤️Call Girl Service In Chandigarh☎️9814379184☎️ Call Girl in Chandigarh☎️ Cha...
❤️Call Girl Service In Chandigarh☎️9814379184☎️ Call Girl in Chandigarh☎️ Cha...
 
Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
 
7 steps How to prevent Thalassemia : Dr Sharda Jain & Vandana Gupta
7 steps How to prevent Thalassemia : Dr Sharda Jain & Vandana Gupta7 steps How to prevent Thalassemia : Dr Sharda Jain & Vandana Gupta
7 steps How to prevent Thalassemia : Dr Sharda Jain & Vandana Gupta
 
💰Call Girl In Bangalore☎️63788-78445💰 Call Girl service in Bangalore☎️Bangalo...
💰Call Girl In Bangalore☎️63788-78445💰 Call Girl service in Bangalore☎️Bangalo...💰Call Girl In Bangalore☎️63788-78445💰 Call Girl service in Bangalore☎️Bangalo...
💰Call Girl In Bangalore☎️63788-78445💰 Call Girl service in Bangalore☎️Bangalo...
 
tongue disease lecture Dr Assadawy legacy
tongue disease lecture Dr Assadawy legacytongue disease lecture Dr Assadawy legacy
tongue disease lecture Dr Assadawy legacy
 
Cardiac Output, Venous Return, and Their Regulation
Cardiac Output, Venous Return, and Their RegulationCardiac Output, Venous Return, and Their Regulation
Cardiac Output, Venous Return, and Their Regulation
 
💚Call Girls In Amritsar 💯Anvi 📲🔝8725944379🔝Amritsar Call Girl No💰Advance Cash...
💚Call Girls In Amritsar 💯Anvi 📲🔝8725944379🔝Amritsar Call Girl No💰Advance Cash...💚Call Girls In Amritsar 💯Anvi 📲🔝8725944379🔝Amritsar Call Girl No💰Advance Cash...
💚Call Girls In Amritsar 💯Anvi 📲🔝8725944379🔝Amritsar Call Girl No💰Advance Cash...
 
Independent Bangalore Call Girls (Adult Only) 💯Call Us 🔝 7304373326 🔝 💃 Escor...
Independent Bangalore Call Girls (Adult Only) 💯Call Us 🔝 7304373326 🔝 💃 Escor...Independent Bangalore Call Girls (Adult Only) 💯Call Us 🔝 7304373326 🔝 💃 Escor...
Independent Bangalore Call Girls (Adult Only) 💯Call Us 🔝 7304373326 🔝 💃 Escor...
 
Circulatory Shock, types and stages, compensatory mechanisms
Circulatory Shock, types and stages, compensatory mechanismsCirculatory Shock, types and stages, compensatory mechanisms
Circulatory Shock, types and stages, compensatory mechanisms
 
Low Cost Call Girls Bangalore {9179660964} ❤️VVIP NISHA Call Girls in Bangalo...
Low Cost Call Girls Bangalore {9179660964} ❤️VVIP NISHA Call Girls in Bangalo...Low Cost Call Girls Bangalore {9179660964} ❤️VVIP NISHA Call Girls in Bangalo...
Low Cost Call Girls Bangalore {9179660964} ❤️VVIP NISHA Call Girls in Bangalo...
 
Call Girls in Lucknow Just Call 👉👉 8875999948 Top Class Call Girl Service Ava...
Call Girls in Lucknow Just Call 👉👉 8875999948 Top Class Call Girl Service Ava...Call Girls in Lucknow Just Call 👉👉 8875999948 Top Class Call Girl Service Ava...
Call Girls in Lucknow Just Call 👉👉 8875999948 Top Class Call Girl Service Ava...
 
Kolkata Call Girls Shobhabazar 💯Call Us 🔝 8005736733 🔝 💃 Top Class Call Gir...
Kolkata Call Girls Shobhabazar  💯Call Us 🔝 8005736733 🔝 💃  Top Class Call Gir...Kolkata Call Girls Shobhabazar  💯Call Us 🔝 8005736733 🔝 💃  Top Class Call Gir...
Kolkata Call Girls Shobhabazar 💯Call Us 🔝 8005736733 🔝 💃 Top Class Call Gir...
 
💰Call Girl In Bangalore☎️7304373326💰 Call Girl service in Bangalore☎️Bangalor...
💰Call Girl In Bangalore☎️7304373326💰 Call Girl service in Bangalore☎️Bangalor...💰Call Girl In Bangalore☎️7304373326💰 Call Girl service in Bangalore☎️Bangalor...
💰Call Girl In Bangalore☎️7304373326💰 Call Girl service in Bangalore☎️Bangalor...
 
💚Chandigarh Call Girls Service 💯Piya 📲🔝8868886958🔝Call Girls In Chandigarh No...
💚Chandigarh Call Girls Service 💯Piya 📲🔝8868886958🔝Call Girls In Chandigarh No...💚Chandigarh Call Girls Service 💯Piya 📲🔝8868886958🔝Call Girls In Chandigarh No...
💚Chandigarh Call Girls Service 💯Piya 📲🔝8868886958🔝Call Girls In Chandigarh No...
 
Call Girls Bangalore - 450+ Call Girl Cash Payment 💯Call Us 🔝 6378878445 🔝 💃 ...
Call Girls Bangalore - 450+ Call Girl Cash Payment 💯Call Us 🔝 6378878445 🔝 💃 ...Call Girls Bangalore - 450+ Call Girl Cash Payment 💯Call Us 🔝 6378878445 🔝 💃 ...
Call Girls Bangalore - 450+ Call Girl Cash Payment 💯Call Us 🔝 6378878445 🔝 💃 ...
 
Difference Between Skeletal Smooth and Cardiac Muscles
Difference Between Skeletal Smooth and Cardiac MusclesDifference Between Skeletal Smooth and Cardiac Muscles
Difference Between Skeletal Smooth and Cardiac Muscles
 
Call 8250092165 Patna Call Girls ₹4.5k Cash Payment With Room Delivery
Call 8250092165 Patna Call Girls ₹4.5k Cash Payment With Room DeliveryCall 8250092165 Patna Call Girls ₹4.5k Cash Payment With Room Delivery
Call 8250092165 Patna Call Girls ₹4.5k Cash Payment With Room Delivery
 
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
 
Kolkata Call Girls Service ❤️🍑 9xx000xx09 👄🫦 Independent Escort Service Kolka...
Kolkata Call Girls Service ❤️🍑 9xx000xx09 👄🫦 Independent Escort Service Kolka...Kolkata Call Girls Service ❤️🍑 9xx000xx09 👄🫦 Independent Escort Service Kolka...
Kolkata Call Girls Service ❤️🍑 9xx000xx09 👄🫦 Independent Escort Service Kolka...
 

Comparison of Compounds-to-targets between Databases

  • 1. Comparison of Compound-to-Target Relationships in Chemogenomic and Drug Databases Aprill 2012 update: FYI these two blog posts are on the same theme http://cdsouthan.blogspot.se/2012/01/our-human-beta-lactamase-is-not_09.html http://cdsouthan.blogspot.se/2011/08/compound-to-target-mappings-part-i.html Chris Southan ChrisDS Consulting, Göteborg, Sweden, Presented to the NCBI PubChem team on 11 April. the BioIT World Chemogenomics and Toxicogenomics Workshop on 12 April Boston, USA, and as a shorter version, the ChEMBL users meeting at the EBI, 27 may 2011 [1]
  • 2. Aknowledgments and Context • I profoundly appreciate the efforts of those who develop, manage and maintain public resources specified here and many others I enjoy acessing • I have some history in evaluating the utility, exploitation and content quality of both bioinformatics and cheminformatics databases. I thus enjoy the dual roles (roughly in equal parts) of both fan and critic • All databases have imperfections. This presentation investigates a selection of these but critical analysis should not be missinterpreted as disparaging either the quality of primary sources or the work of curators and database teams [2]
  • 3. Outline • Mapping concepts sources and challenges • Extremes of the distribution • Atorvastatin, drug-to-targets • Hmg-CoA reductase target-to-drugs • Equivocal mapping examples • Exploring data intersects • Complex targets • Conclusions and outlook [3]
  • 4. Activity-to-compound-to-protein Mapping: Capturing Relationships Between four Concepts MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGG APLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQ GYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHR YYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSI PHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEI ARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSE VLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIV RVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFE AAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNI FPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDD CYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAV SACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTL MTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQHD DFADDISLLK Document Assay Result Compound Protein Expert extraction and curation Unstructured data Structured data Papers & Patents Databases [4]
  • 5. The D-A-R-C-P Axis Pathway/module/ system [5]
  • 6. Compound and drug-to-target Collations D-A-R-C-P Targets = 5,662 protein targets, cpds = 284,206 data points = 648,915, D-A-R-C-P Targets = 8,091 Small Molecules = 658,075, data points = 3,030,317 (D)-A-R-C-P-S BioAssays extracted from literature (ChEMBL) = 499,520, Direct screening assays = 3,208, active Compounds = 23,677, Targets = 447 D-C-P-S Approved cpds = 1431 , Targets = 1458, Experimental cpds = 5212, research targets = 3206 D-C-P Targets = 358 successful, 251 clinical trial and 1,254 research, Drugs = 1,511 approved, 1,118 clinical trial and 2,331 experimental [6]
  • 7. PDB Drug-to- Protein Mappings in DrugPort [7]
  • 8. Target Mapping: Curatorial Challenges • Target = (infered) direct binding • Primary (bona fide) target = therapeutic causality • Polytargets = multiple • Para-target = sub-family specificity • Ortho-target = cross-species specificity • Cross-screen = non-homologous • Non-target (e.g. trypsin, albumin) • Off-target = liability (ADR or side effect) • Anti-target = known libaility (e.g. HERG) • Indirect target = non-binding (e.g. APP) • Complex = resolvable to sequence IDs (eg proteosome) • Complex = experimentaly unresolved (e.g. PDE5s) • Ambigous = lack of metadata or curatorial judgment (e.g. BACE) • Non-canonical = where metadata specifies mutation, splice or PTM • Metabo-target = metabolic interactions • Transport-target = transporters [8]
  • 10. One target-to-many compounds: Dopamine Receptor D2 [10]
  • 11. One compound-to-(367)- proteins [11]
  • 12. Mapping sources for the top selling drug [12]
  • 13. Target Matrix for Atorvastatin Swiss-Prot ChEMBL TTD DrugBa PubChem (BindingD nk B) HMDH_HUMAN X X X (PDB) X HMDH_RAT X X DPP4_HUMAN X DPP4_PIG X AHR_HUMAN X [13]
  • 14. Other Statins: Different BioAssay Coverages [14]
  • 15. Diferent PubChem CIDs map to different submissions, structures and activity profiles Atorvastatin -> 10 CID name matches Substances 397 Links Same structure: 33 Links Mixture: 364 Links CID 60823 39 canonical Substances: 19 Links [15]
  • 17. Drugs mapped to HMG-CoA as target Swiss-Prot cross-reference [17]
  • 19. Swiss-Prot Target Intersects • 1,627 results for database:(type:drugbank) • 297 results for database:(type:bindingdb) • 45 results for database:(type:bindingdb) AND database:(type:drugbank) AND organism:"Homo sapiens [19]
  • 21. Mannitol: drug ? yes - ligand ? yes ? target ? no [21]
  • 22. Polypropylene Glycol: drug ? no, ligand ? maybe, target ? no [22]
  • 24. Antifreeze: drug ?, no, ligand ? no, 154 targets ? no Wikipedia: Ethylene glycol is moderately toxic with an oral LDLO = 786 mg/kg for humans [24]
  • 27. Secretase matches in TTD Mixed-concept targets but no small-molecule true positives [27]
  • 28. Gamma Secretase Activity: Variable Subunit Mappings [28]
  • 29. APP: Indirect Target, three mechanisms “for small molecules that suppress the Amyloid Precursor Protein (APP) translation by binding to the 5'Untranslated Region of the APP mRNA [29]
  • 30. Proteasome: Target Descriptions and Cross- screens for Bortzemib [30]
  • 31. PubChem Compound Intersects: Primary Drug Targets with Screening data [31]
  • 33. Mycophenolic acid and Prodrug: Complex mappings • Primary Target human IMPDH2 • IMPDH1 ? • IMPDH2 hamster • IMPDH2 Tritrichomonas • myfortic is an enteric-coated formulation of MPA in a delayed- release tablet. [33]
  • 34. Conclusions • Compared to what we had even a few years ago, let alone in LBPC (life-before-PubChem) these compound-to-protein sources are fantastic • However, most things that could go wrong have • We don’t often see QC statistics • Data coverage is patchy, ad hoc and can be circular • If you operate on these data at large scale you have no choice but to ”trust and filter” • If detailed realationships are important you need to ”verify and judge” back to the primary source • You can only really do this if you have at least some in vitro background rather than just in silico [34]
  • 35. Wouldn’t it be nice if we had .... • Interpreted mapping distribution statisitcs for each database • Details about extraction triages, curation rules and parsing logic • Harmonisation of mapping rules and cross-comparison of content • Clear declarations and statistics of circularity between databases • Curator judgments overuling document primacy • Consolidated and extended Swiss-Prot cross-references • Assay and target ontologies (Pistoia ? Open Phacts ?) • “Standardization of Enzyme Data” (STRENDA, http://www.beilstein- institut.de/en/projekte/strenda/) • “Minimum Information About a Bioactive Entity” (MIABE, http://www.psidev.info/index.php?q=node/394) [35]
  • 37. [37]

Notas do Editor

  1. Primary, Secondary and tertiary literature Overlap BDB, ChEMBL PC
  2. MLSN collection and/or NGSC screening collections
  3. No ChEMBL activity flag FDA lable is hemi-calcium trihydrate PDB not an assay
  4. Yeast growth assay as new screen
  5. Expression pattern - party hub or date hub
  6. No TTD