SlideShare uma empresa Scribd logo
1 de 23
This presentation is
brought to you by
Grammar Bytes!,
©2023 by Robin L.
Simmons.
Parallel Structure
Do I maintain
parallelism
with a
participle?
Or should I
use an
infinitive?
This
presentation
covers
distinguishing
between
parallel and
non-parallel
elements.
A parallelism item on an
objective test might look
like this ...
Sample Item
A. Eileen bought new shoes for the party, a gold charm for
her mother, and to treat her best friend Maria to lunch.
B. Eileen decided to buy new shoes for the party,
purchasing a gold charm for her mother, and treating
her best friend Maria to lunch.
C. Eileen purchased new shoes for the party, a gold
charm for her mother, and lunch for Maria, her best
friend.
A. Eileen bought new shoes for the party, a gold charm for
her mother, and to treat her best friend Maria to lunch.
B. Eileen decided to buy new shoes for the party,
purchasing a gold charm for her mother, and treating
her best friend Maria to lunch.
C. Eileen purchased new shoes for the party, a gold
charm for her mother, and lunch for Maria, her best
friend.
Directions: Choose the sentence that has no errors in
structure.
Parallelism looks like this:
Items in a series must
have parallel structure.
Shane , , and
Shane , , and
.
.
Here is an example:
Shane ate the pizza, wiped his lips, and
burped with contentment.
Ate = past tense verb;
wiped = past tense
verb; and burped =
past tense verb.
Non-parallel structure looks like this:
Don’t create problems by
mixing grammatical elements.
Shane , , and
Shane , , and
.
.
The problem looks like
this:
Shane ate the pizza, wiped his lips, and
burping with contentment.
Now look what you’ve
done! Ate and wiped
= past tense verbs, but
burping = present
participle!
Quick Test, Part 1
Directions: In the items that follow, choose
the sentence that has no errors in structure.
Let’s see
how you
perform!
Item 1
A. Barking dogs, kittens that were meowing, and
squawking parakeets greet the pet shop
visitors.
B. Barking dogs, meowing kittens, and squawking
parakeets greet the pet shop visitors.
C. Dogs that bark, kittens that meow, and
parakeets squawking greet the pet shop
visitors.
A. Barking dogs, kittens that were meowing, and
squawking parakeets greet the pet shop
visitors.
B. Barking dogs, meowing kittens, and
squawking parakeets greet the pet shop
visitors.
C. Dogs that bark, kittens that meow, and
parakeets squawking greet the pet shop
visitors.
Item 2
A. During class, Samuel spent his time flirting with
Brittney, eating candy, and doodling on the
assignment sheet.
B. During class, Samuel spent his time flirting with
Brittney, he ate candy, and doodling on the
assignment sheet.
C. During class, Samuel spent his time to flirt with
Brittney, to eat candy, and doodling on the
assignment sheet.
A. During class, Samuel spent his time flirting
with Brittney, eating candy, and doodling on
the assignment sheet.
B. During class, Samuel spent his time flirting with
Brittney, he ate candy, and doodling on the
assignment sheet.
C. During class, Samuel spent his time to flirt with
Brittney, to eat candy, and doodling on the
assignment sheet.
Item 3
A. Alex looked everywhere for his math book—
under the bed, on his desk, and he searched
inside the refrigerator.
B. Alex looked everywhere for his math book—
viewing under the bed, searching on his desk,
and inside the refrigerator.
C. Alex looked everywhere for his math book—
under the bed, on his desk, and inside the
refrigerator.
A. Alex looked everywhere for his math book—
under the bed, on his desk, and he searched
inside the refrigerator.
B. Alex looked everywhere for his math book—
viewing under the bed, searching on his desk,
and inside the refrigerator.
C. Alex looked everywhere for his math book—
under the bed, on his desk, and inside the
refrigerator.
Item 4
A. The manager wanted staff who arrived on time,
smiled at the customers, and didn’t snack on
the chicken nuggets.
B. The manager wanted staff who arrived on time,
would be smiling at the customers, and would
not be snacking on the chicken nuggets.
C. The manager wanted staff who arrived on time,
smiled at the customers, and no snacking on
the chicken nuggets.
A. The manager wanted staff who arrived on
time, smiled at the customers, and didn’t
snack on the chicken nuggets.
B. The manager wanted staff who arrived on time,
would be smiling at the customers, and would
not be snacking on the chicken nuggets.
C. The manager wanted staff who arrived on time,
smiled at the customers, and no snacking on
the chicken nuggets.
Item 5
A. After giving Jeremy her phone number, Felicia had
to tolerate his late night calls, stupid conversations,
and requests for her math homework.
B. After giving Jeremy her phone number, Felicia had
to tolerate his late night calls, the fact that he
carried on stupid conversations, and requests for
her math homework.
C. After giving Jeremy her phone number, Felicia had
to tolerate being woken up late at night, having
stupid conversations, and he constantly requested
her math homework.
A. After giving Jeremy her phone number, Felicia
had to tolerate his late night calls, stupid
conversations, and requests for her math
homework.
B. After giving Jeremy her phone number, Felicia had
to tolerate his late night calls, the fact that he
carried on stupid conversations, and requests for
her math homework.
C. After giving Jeremy her phone number, Felicia had
to tolerate being woken up late at night, having
stupid conversations, and he constantly requested
her math homework.
Quick Test, Part 2
Directions: In the items that follow, choose
the correct word or phrase within the context
suggested by the sentence.
Now try a
different
type!
Item 6
Pasta boiling in water, __________, and garlic
bread baking in the oven welcomed Francisco as
he opened the door.
A. simmered tomato sauce in the pan
B. tomato sauce simmering in the pan
C. tomato sauce that simmered in the pan
D. saucy tomatoes that were simmering in the pan
Pasta boiling in water, __________, and garlic
bread baking in the oven welcomed Francisco as
he opened the door.
A. simmered tomato sauce in the pan
B. tomato sauce simmering in the pan
C. tomato sauce that simmered in the pan
D. saucy tomatoes that were simmering in the pan
Item 7
During our vacation in the Bahamas, we hope
__________, to enjoy beautiful sunsets, and to
dance ourselves dizzy at reggae clubs.
A. that we eat delicious seafood
B. that eating delicious seafood occurs
C. to eat delicious seafood
D. eating delicious seafood
During our vacation in the Bahamas, we hope
__________, to enjoy beautiful sunsets, and to
dance ourselves dizzy at reggae clubs.
A. that we eat delicious seafood
B. that eating delicious seafood occurs
C. to eat delicious seafood
D. eating delicious seafood
Item 8
Karen wished Ray chewed with his mouth closed,
for otherwise he was everything she wanted in a
date; he was tall, intelligent, and __________.
A. he looked good
B. being good looking
C. one handsome man to look at
D. handsome
Karen wished Ray chewed with his mouth closed,
for otherwise he was everything she wanted in a
date; he was tall, intelligent, and __________.
A. he looked good
B. being good looking
C. one handsome man to look at
D. handsome
Item 9
To win Laurie’s love, Albert visited the florist for
roses, the drugstore for a box of chocolates, and
__________.
A. bought an expensive gold necklace at the
jewelry store
B. the jeweler for an expensive gold necklace
C. the jeweler where he bought an expensive gold
necklace
D. to buy an expensive gold necklace
To win Laurie’s love, Albert visited the florist for
roses, the drugstore for a box of chocolates, and
__________.
A. bought an expensive gold necklace at the
jewelry store
B. the jeweler for an expensive gold necklace
C. the jeweler where he bought an expensive gold
necklace
D. to buy an expensive gold necklace
Item 10
Kimberly won’t date Terry because he is too short,
too noisy, and _________.
A. because he picks his teeth with his fingers
B. too impolite
C. is the most impolite man she has ever met
D. Picking his teeth with his fingers
Kimberly won’t date Terry because he is too short,
too noisy, and _________.
A. because he picks his teeth with his fingers
B. too impolite
C. is the most impolite man she has ever met
D. Picking his teeth with his fingers
Grammar Bytes!
provides additional
handouts and exercises on
parallel structure.
Go to
chompchomp.com!
The End.

Mais conteúdo relacionado

Mais procurados

All types of conditionals and wish
All types of conditionals and wishAll types of conditionals and wish
All types of conditionals and wish
Romanychch
 
Simple present tense
Simple present tenseSimple present tense
Simple present tense
Abeer Khatib
 
9 Logical Fallacies
9 Logical Fallacies9 Logical Fallacies
9 Logical Fallacies
kidkhaos7
 
Module 8 INTERJECTION
Module 8 INTERJECTIONModule 8 INTERJECTION
Module 8 INTERJECTION
Jenny Sanchez
 
CONDITIONAL SENTENCES (RULES AND EXERCISES)
CONDITIONAL SENTENCES (RULES AND EXERCISES)CONDITIONAL SENTENCES (RULES AND EXERCISES)
CONDITIONAL SENTENCES (RULES AND EXERCISES)
Lukitas Leon
 

Mais procurados (20)

Imperative Sentence
Imperative SentenceImperative Sentence
Imperative Sentence
 
First conditional
First conditionalFirst conditional
First conditional
 
Past unreal conditional
Past unreal conditionalPast unreal conditional
Past unreal conditional
 
Conditional if
Conditional  ifConditional  if
Conditional if
 
COT_1_PPT.pptx.pdf
COT_1_PPT.pptx.pdfCOT_1_PPT.pptx.pdf
COT_1_PPT.pptx.pdf
 
English 9 Quarter 4 Week 5 .pptx
English 9 Quarter 4 Week 5 .pptxEnglish 9 Quarter 4 Week 5 .pptx
English 9 Quarter 4 Week 5 .pptx
 
Verb + verb or that clause patterns
Verb + verb or that clause patternsVerb + verb or that clause patterns
Verb + verb or that clause patterns
 
Modal Verbs
Modal Verbs Modal Verbs
Modal Verbs
 
All types of conditionals and wish
All types of conditionals and wishAll types of conditionals and wish
All types of conditionals and wish
 
Simple present tense
Simple present tenseSimple present tense
Simple present tense
 
Conditional Sentence
Conditional SentenceConditional Sentence
Conditional Sentence
 
Wish clauses
Wish clausesWish clauses
Wish clauses
 
Conjunctions
ConjunctionsConjunctions
Conjunctions
 
English: modal auxiliary verbs (theory and examples)
English: modal auxiliary verbs (theory and examples)English: modal auxiliary verbs (theory and examples)
English: modal auxiliary verbs (theory and examples)
 
english-8-dll-3rd (1).docx
english-8-dll-3rd (1).docxenglish-8-dll-3rd (1).docx
english-8-dll-3rd (1).docx
 
9 Logical Fallacies
9 Logical Fallacies9 Logical Fallacies
9 Logical Fallacies
 
Wishes and Regrets
Wishes and RegretsWishes and Regrets
Wishes and Regrets
 
Module 8 INTERJECTION
Module 8 INTERJECTIONModule 8 INTERJECTION
Module 8 INTERJECTION
 
Adverb clauses condition
Adverb clauses conditionAdverb clauses condition
Adverb clauses condition
 
CONDITIONAL SENTENCES (RULES AND EXERCISES)
CONDITIONAL SENTENCES (RULES AND EXERCISES)CONDITIONAL SENTENCES (RULES AND EXERCISES)
CONDITIONAL SENTENCES (RULES AND EXERCISES)
 

Semelhante a parallelism.ppt

Punctuation
PunctuationPunctuation
Punctuation
Emily
 
wordchoice enhlish lessons for kids and adults .ppt
wordchoice enhlish lessons for kids and adults  .pptwordchoice enhlish lessons for kids and adults  .ppt
wordchoice enhlish lessons for kids and adults .ppt
boodysomaa1
 

Semelhante a parallelism.ppt (20)

Parallelism (Grammar Bytes)
Parallelism (Grammar Bytes)Parallelism (Grammar Bytes)
Parallelism (Grammar Bytes)
 
Parallelism
Parallelism Parallelism
Parallelism
 
quiz parallelism.pptx
quiz parallelism.pptxquiz parallelism.pptx
quiz parallelism.pptx
 
Modifiers
Modifiers Modifiers
Modifiers
 
spelling.ppt
spelling.pptspelling.ppt
spelling.ppt
 
spelling.ppt
spelling.pptspelling.ppt
spelling.ppt
 
punctuation.ppt
punctuation.pptpunctuation.ppt
punctuation.ppt
 
Punctuation
PunctuationPunctuation
Punctuation
 
Lesson 67 69
Lesson 67 69Lesson 67 69
Lesson 67 69
 
fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.pptfhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
fhcgvjblkhj.iouilkdcghvhhlksvagreement.ppt
 
Comma Splices, Run- On Sentences, and Fragments
Comma Splices, Run- On Sentences, and FragmentsComma Splices, Run- On Sentences, and Fragments
Comma Splices, Run- On Sentences, and Fragments
 
Subject verb Agreement presentation for Students
Subject verb Agreement presentation for StudentsSubject verb Agreement presentation for Students
Subject verb Agreement presentation for Students
 
Punctuation
PunctuationPunctuation
Punctuation
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
wordchoice enhlish lessons for kids and adults .ppt
wordchoice enhlish lessons for kids and adults  .pptwordchoice enhlish lessons for kids and adults  .ppt
wordchoice enhlish lessons for kids and adults .ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
svagreement.ppt
svagreement.pptsvagreement.ppt
svagreement.ppt
 
Run ons & fragments
Run ons & fragmentsRun ons & fragments
Run ons & fragments
 

Mais de NathanielPuda (10)

text context.pptxAHAWYAHQHAOQKQABSQQUAIQ
text context.pptxAHAWYAHQHAOQKQABSQQUAIQtext context.pptxAHAWYAHQHAOQKQABSQQUAIQ
text context.pptxAHAWYAHQHAOQKQABSQQUAIQ
 
sonnet activity.pptxSHDHEUDUWHDHHHASJSWJ
sonnet activity.pptxSHDHEUDUWHDHHHASJSWJsonnet activity.pptxSHDHEUDUWHDHHHASJSWJ
sonnet activity.pptxSHDHEUDUWHDHHHASJSWJ
 
CHAPTER 10 FIRST HOMECOMING.pptxahahshwz
CHAPTER 10 FIRST HOMECOMING.pptxahahshwzCHAPTER 10 FIRST HOMECOMING.pptxahahshwz
CHAPTER 10 FIRST HOMECOMING.pptxahahshwz
 
Short quiz.pptxGGGGGGGGGGGGGGGGGGGGGGGGG
Short quiz.pptxGGGGGGGGGGGGGGGGGGGGGGGGGShort quiz.pptxGGGGGGGGGGGGGGGGGGGGGGGGG
Short quiz.pptxGGGGGGGGGGGGGGGGGGGGGGGGG
 
Lit vs lit.pptxAAAAQQQQSSSDDDDEWWQAASWQD
Lit vs lit.pptxAAAAQQQQSSSDDDDEWWQAASWQDLit vs lit.pptxAAAAQQQQSSSDDDDEWWQAASWQD
Lit vs lit.pptxAAAAQQQQSSSDDDDEWWQAASWQD
 
digital lit short quiz.pptxsdewwqqqqaasd
digital lit short quiz.pptxsdewwqqqqaasddigital lit short quiz.pptxsdewwqqqqaasd
digital lit short quiz.pptxsdewwqqqqaasd
 
1ST QA REVIEWER.pptxcvffghyytreewwaaqsdc
1ST QA REVIEWER.pptxcvffghyytreewwaaqsdc1ST QA REVIEWER.pptxcvffghyytreewwaaqsdc
1ST QA REVIEWER.pptxcvffghyytreewwaaqsdc
 
1 LITERAahsidoswpsoxjsjaxkRY GENRES.pptx
1 LITERAahsidoswpsoxjsjaxkRY GENRES.pptx1 LITERAahsidoswpsoxjsjaxkRY GENRES.pptx
1 LITERAahsidoswpsoxjsjaxkRY GENRES.pptx
 
irony powerpoint.pptshdkfkahwisieidifori
irony powerpoint.pptshdkfkahwisieidiforiirony powerpoint.pptshdkfkahwisieidifori
irony powerpoint.pptshdkfkahwisieidifori
 
Campus-Journalism.docx
Campus-Journalism.docxCampus-Journalism.docx
Campus-Journalism.docx
 

Último

Seal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptxSeal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptx
negromaestrong
 
Beyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global ImpactBeyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global Impact
PECB
 
Gardella_Mateo_IntellectualProperty.pdf.
Gardella_Mateo_IntellectualProperty.pdf.Gardella_Mateo_IntellectualProperty.pdf.
Gardella_Mateo_IntellectualProperty.pdf.
MateoGardella
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
QucHHunhnh
 

Último (20)

Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17
 
Sports & Fitness Value Added Course FY..
Sports & Fitness Value Added Course FY..Sports & Fitness Value Added Course FY..
Sports & Fitness Value Added Course FY..
 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
 
Seal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptxSeal of Good Local Governance (SGLG) 2024Final.pptx
Seal of Good Local Governance (SGLG) 2024Final.pptx
 
ICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptx
 
Unit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxUnit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptx
 
Beyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global ImpactBeyond the EU: DORA and NIS 2 Directive's Global Impact
Beyond the EU: DORA and NIS 2 Directive's Global Impact
 
Measures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeMeasures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and Mode
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introduction
 
Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...
Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...
Ecological Succession. ( ECOSYSTEM, B. Pharmacy, 1st Year, Sem-II, Environmen...
 
Gardella_Mateo_IntellectualProperty.pdf.
Gardella_Mateo_IntellectualProperty.pdf.Gardella_Mateo_IntellectualProperty.pdf.
Gardella_Mateo_IntellectualProperty.pdf.
 
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17  How to Extend Models Using Mixin ClassesMixin Classes in Odoo 17  How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
 
Advance Mobile Application Development class 07
Advance Mobile Application Development class 07Advance Mobile Application Development class 07
Advance Mobile Application Development class 07
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
 
Paris 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityParis 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activity
 
APM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across SectorsAPM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across Sectors
 
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
 
Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
 

parallelism.ppt

  • 1. This presentation is brought to you by Grammar Bytes!, ©2023 by Robin L. Simmons.
  • 2. Parallel Structure Do I maintain parallelism with a participle? Or should I use an infinitive?
  • 4. A parallelism item on an objective test might look like this ...
  • 5. Sample Item A. Eileen bought new shoes for the party, a gold charm for her mother, and to treat her best friend Maria to lunch. B. Eileen decided to buy new shoes for the party, purchasing a gold charm for her mother, and treating her best friend Maria to lunch. C. Eileen purchased new shoes for the party, a gold charm for her mother, and lunch for Maria, her best friend. A. Eileen bought new shoes for the party, a gold charm for her mother, and to treat her best friend Maria to lunch. B. Eileen decided to buy new shoes for the party, purchasing a gold charm for her mother, and treating her best friend Maria to lunch. C. Eileen purchased new shoes for the party, a gold charm for her mother, and lunch for Maria, her best friend. Directions: Choose the sentence that has no errors in structure.
  • 6. Parallelism looks like this: Items in a series must have parallel structure. Shane , , and Shane , , and . .
  • 7. Here is an example: Shane ate the pizza, wiped his lips, and burped with contentment. Ate = past tense verb; wiped = past tense verb; and burped = past tense verb.
  • 8. Non-parallel structure looks like this: Don’t create problems by mixing grammatical elements. Shane , , and Shane , , and . .
  • 9. The problem looks like this: Shane ate the pizza, wiped his lips, and burping with contentment. Now look what you’ve done! Ate and wiped = past tense verbs, but burping = present participle!
  • 10. Quick Test, Part 1 Directions: In the items that follow, choose the sentence that has no errors in structure. Let’s see how you perform!
  • 11. Item 1 A. Barking dogs, kittens that were meowing, and squawking parakeets greet the pet shop visitors. B. Barking dogs, meowing kittens, and squawking parakeets greet the pet shop visitors. C. Dogs that bark, kittens that meow, and parakeets squawking greet the pet shop visitors. A. Barking dogs, kittens that were meowing, and squawking parakeets greet the pet shop visitors. B. Barking dogs, meowing kittens, and squawking parakeets greet the pet shop visitors. C. Dogs that bark, kittens that meow, and parakeets squawking greet the pet shop visitors.
  • 12. Item 2 A. During class, Samuel spent his time flirting with Brittney, eating candy, and doodling on the assignment sheet. B. During class, Samuel spent his time flirting with Brittney, he ate candy, and doodling on the assignment sheet. C. During class, Samuel spent his time to flirt with Brittney, to eat candy, and doodling on the assignment sheet. A. During class, Samuel spent his time flirting with Brittney, eating candy, and doodling on the assignment sheet. B. During class, Samuel spent his time flirting with Brittney, he ate candy, and doodling on the assignment sheet. C. During class, Samuel spent his time to flirt with Brittney, to eat candy, and doodling on the assignment sheet.
  • 13. Item 3 A. Alex looked everywhere for his math book— under the bed, on his desk, and he searched inside the refrigerator. B. Alex looked everywhere for his math book— viewing under the bed, searching on his desk, and inside the refrigerator. C. Alex looked everywhere for his math book— under the bed, on his desk, and inside the refrigerator. A. Alex looked everywhere for his math book— under the bed, on his desk, and he searched inside the refrigerator. B. Alex looked everywhere for his math book— viewing under the bed, searching on his desk, and inside the refrigerator. C. Alex looked everywhere for his math book— under the bed, on his desk, and inside the refrigerator.
  • 14. Item 4 A. The manager wanted staff who arrived on time, smiled at the customers, and didn’t snack on the chicken nuggets. B. The manager wanted staff who arrived on time, would be smiling at the customers, and would not be snacking on the chicken nuggets. C. The manager wanted staff who arrived on time, smiled at the customers, and no snacking on the chicken nuggets. A. The manager wanted staff who arrived on time, smiled at the customers, and didn’t snack on the chicken nuggets. B. The manager wanted staff who arrived on time, would be smiling at the customers, and would not be snacking on the chicken nuggets. C. The manager wanted staff who arrived on time, smiled at the customers, and no snacking on the chicken nuggets.
  • 15. Item 5 A. After giving Jeremy her phone number, Felicia had to tolerate his late night calls, stupid conversations, and requests for her math homework. B. After giving Jeremy her phone number, Felicia had to tolerate his late night calls, the fact that he carried on stupid conversations, and requests for her math homework. C. After giving Jeremy her phone number, Felicia had to tolerate being woken up late at night, having stupid conversations, and he constantly requested her math homework. A. After giving Jeremy her phone number, Felicia had to tolerate his late night calls, stupid conversations, and requests for her math homework. B. After giving Jeremy her phone number, Felicia had to tolerate his late night calls, the fact that he carried on stupid conversations, and requests for her math homework. C. After giving Jeremy her phone number, Felicia had to tolerate being woken up late at night, having stupid conversations, and he constantly requested her math homework.
  • 16. Quick Test, Part 2 Directions: In the items that follow, choose the correct word or phrase within the context suggested by the sentence. Now try a different type!
  • 17. Item 6 Pasta boiling in water, __________, and garlic bread baking in the oven welcomed Francisco as he opened the door. A. simmered tomato sauce in the pan B. tomato sauce simmering in the pan C. tomato sauce that simmered in the pan D. saucy tomatoes that were simmering in the pan Pasta boiling in water, __________, and garlic bread baking in the oven welcomed Francisco as he opened the door. A. simmered tomato sauce in the pan B. tomato sauce simmering in the pan C. tomato sauce that simmered in the pan D. saucy tomatoes that were simmering in the pan
  • 18. Item 7 During our vacation in the Bahamas, we hope __________, to enjoy beautiful sunsets, and to dance ourselves dizzy at reggae clubs. A. that we eat delicious seafood B. that eating delicious seafood occurs C. to eat delicious seafood D. eating delicious seafood During our vacation in the Bahamas, we hope __________, to enjoy beautiful sunsets, and to dance ourselves dizzy at reggae clubs. A. that we eat delicious seafood B. that eating delicious seafood occurs C. to eat delicious seafood D. eating delicious seafood
  • 19. Item 8 Karen wished Ray chewed with his mouth closed, for otherwise he was everything she wanted in a date; he was tall, intelligent, and __________. A. he looked good B. being good looking C. one handsome man to look at D. handsome Karen wished Ray chewed with his mouth closed, for otherwise he was everything she wanted in a date; he was tall, intelligent, and __________. A. he looked good B. being good looking C. one handsome man to look at D. handsome
  • 20. Item 9 To win Laurie’s love, Albert visited the florist for roses, the drugstore for a box of chocolates, and __________. A. bought an expensive gold necklace at the jewelry store B. the jeweler for an expensive gold necklace C. the jeweler where he bought an expensive gold necklace D. to buy an expensive gold necklace To win Laurie’s love, Albert visited the florist for roses, the drugstore for a box of chocolates, and __________. A. bought an expensive gold necklace at the jewelry store B. the jeweler for an expensive gold necklace C. the jeweler where he bought an expensive gold necklace D. to buy an expensive gold necklace
  • 21. Item 10 Kimberly won’t date Terry because he is too short, too noisy, and _________. A. because he picks his teeth with his fingers B. too impolite C. is the most impolite man she has ever met D. Picking his teeth with his fingers Kimberly won’t date Terry because he is too short, too noisy, and _________. A. because he picks his teeth with his fingers B. too impolite C. is the most impolite man she has ever met D. Picking his teeth with his fingers
  • 22. Grammar Bytes! provides additional handouts and exercises on parallel structure. Go to chompchomp.com!