SlideShare uma empresa Scribd logo
1 de 4
ECWAY TECHNOLOGIES
IEEE PROJECTS & SOFTWARE DEVELOPMENTS
OUR OFFICES @ CHENNAI / TRICHY / KARUR / ERODE / MADURAI / SALEM / COIMBATORE
BANGALORE / HYDRABAD
CELL: +91 98949 17187 | +91 875487 1111 / 2111 / 3111 / 4111 / 5111 / 6111 / 8111
VISIT: www.ecwayprojects.com Mailto: ecwaytechnologies@gmail.com

IEEE EMBEDDED 2013-2014
1

A contest-oriented project for learning intelligent mobile robots

2

A low cost web based remote monitoring system with built-in security feature for vulnerable
environments

3

A smart prepaid energy metering system to control electricity theft

4

Scaling Energy Per Operation via an Asynchronous Pipeline

5

A wearable inertial-sensing-based body sensor network for shoulder range of motion assessment

6

A wireless electrocardiogram detection for personal health monitoring

7

A ZIGBEE SMS alert system with trust mechanism in wireless sensor networks

8

A ZIGBEE-based wireless wearable electronic nose using flexible printed sensor array

9

An apparatus in monitoring the energy charging system

10

An embedded system for an EEG based BCI

11

Application of temperature compensated ultrasonic ranging for blind person and verification using
Matlab

12

Automated control system for air pollution detection in vehicles

13

Automatic speed and torque monitoring in induction motors using ZIGBEE and SMS

14

Biomedical sensor network for cardiovascular fitness and activity monitoring

15

Building point of care health technologies on the IEEE 11073 health device standards

16

Capacitive seat sensors for multiple occupancy detection using a low-cost setup

17

Communication networks of domestic small-scale renewable energy systems

18

Coordinator

traffic

diffusion

for

data-intensive

ZIGBEE

transmission

in

real-time

electrocardiography monitoring
19

Design and development of digital PID controller for dc motor drive system using embedded
platform for mobile robot
20

Design and development of pic microcontroller based vehicle monitoring system using controller
area network (can) protocol

21

Design and fabrication of a miniaturized ECG system with Bluetooth connectivity

22

Dynamic wireless sensor networks for real time safeguard of workers exposed to physical agents in
constructions sites

23

Environment monitoring and device control using arm based embedded controlled sensor network

24

High-temperature uhf RFID sensor measurements in a full-metal environment

25

Human health monitoring mobile phone application by using the wireless Nano sensor based
embedded system

26

Integrated design of efficient & reliable motor drive and PFC using low cost microcontroller with
embedded PGA’s and CLA

27

Intelligent monitoring and control rendered to street lighting

28

Intelligent technologies for self-sustaining, RFID-based, rural e health systems

29

Introduction of electromagnetic image-based chip less RFID system

30

Low power wireless sensor network for building monitoring

31

Mobile robot localization using the phase of passive uhf-RFID signals

32

Multi-platform wireless measurement system for continuous bio-monitoring

33

Optimal angular movement of laser beam in SPR using an embedded controller

34

Passenger bus alert system for easy navigation of blind

35

Portable wireless biomedical temperature monitoring system: architecture and implementation

36

Power consumption in direct interface circuits

37

Remote-control system of high efficiency and intelligent street lighting using a ZIGBEE network of
devices and sensors

38

RFID range extensions with low-power wireless edge devices

39

RFID-based digital content copy protection system in movie and audio rental agency

40

Smart host microcontroller for optimal battery charging in a solar-powered robotic vehicle

41

Solar powered water quality monitoring system using wireless sensor network

42

The ultrasonic distance alarm system based on msp430f449

43

Towards the implementation of IOT for environmental condition monitoring in homes

44

Water environment monitoring system based on ZIGBEE technology

45

Wireless access control system based on IEEE 802.15.4

46

Wireless sensor network for multi-storey building: design and implementation

47

ZIGBEE and atmega32 based wireless digital control and monitoring system for led lighting

48

Building point of care health technology on the IEEE 11073 health device standards

49

Monitoring of cigarette smoking using wearable sensors and support vector machines

50

A Low-Complexity Turbo Decoder Architecture for Energy-Efficient Wireless Sensor Networks

51

Scaling Energy Per Operation via an Asynchronous Pipeline
52

ROBOTICS- Covering Points of Interest with Mobile Sensors

53

Concurrent Multiresource Arbiter Design and Applications

54

Distributed Multiple ConstraintsGeneralizedSidelobe Canceler for Fully Connected Wireless
Acoustic Sensor Networks

55

Exponential and Power Law Distribution of Contact Duration in Urban Vehicular Ad Hoc Networks

56

On the Reconstruction of Quad-Pol SAR Data From Compact Polarimetry Data For Ocean Target
Detection

58

Pragmatic Integration of an SRAM Row Cache in Heterogeneous 3-D DRAM Architecture Using TSV

59

Real-Time Implementation of the Vertex Component Analysis Algorithm on GPUs

60

Real-Time IO Management System with COTS Peripherals

IEEE 2013 IMAGE PROCESSING
1

Optical flow estimation for flame detection in videos

2

Image sharpness assessment based on local phase coherence

3

Structural texture similarity metrics for image analysis and retrieval

4

Dimensionality reduction for registration of high-dimensional data sets

5

Exploring visual and motion saliency for automatic video object extraction

6

Image in-painting on the basis of spectral structure from 2-d non-harmonic analysis

7

Efficient minimum error bounded particle re-sampling l1 tracker with occlusion detection

8

GPU accelerated edge-region based level set evolution constrained by 2d gray-scale histogram

9

Recursive histogram modification: establishing equivalency between reversible data hiding and
lossless data compression

10

Integration of Gibbs Markova random field and Hopfield-type neural networks for unsupervised
change detection in remotely sensed multi-temporal images

IEEE 2013 COMMUNICATIONS
1

Blind symbol timing and CFO estimation for OFDM/OQAM systems

2

A peak power efficient cooperative diversity using STAR-QAM with coherent/non-coherent
detection

3

On the effect of outdated channel estimation in variable gain relaying: error performance and
PAPR

4

Decoding and performance bound of demodulate-and-forward based distributed ALAMOUTI STBC

2013 IEEE PROJECT TITLES *** [PLC]
1.

A Comprehensive Solution for Deterministic Replay Debugging of SoftPLC Applications

2.

Power-Line Communication in Medium- Voltage System: Simulation Model and Onfield Experimental
Tests
3.

Methods for Reliable Simulation-Based PLC Code Verification

4.

Performance of HTTP Protocol in Networked Control Systems

5.

Oil-Filled MV/LV Power-Transformer Behavior in Narrow-Band Power-Line Communication Systems

6.

A Time-Domain Model of Background Noise for In-Home MIMO PLC Networks

7.

Automatic Generation of the Supervisor Code for Industrial Switched-Mode Systems

8.

Dealing With Unknown Impedance and Impulsive Noise in the Power-Line Communications Channel

9.

Development of PLC-based software for increasing the dependability of production automation
systems

10.

Multi-DSP and -FPGA-Based Fully Digital Control System for Cascaded Multilevel Converters Used in
FACTS Applications

11.

PLC-Based Model of Reactive Power Flow in Steam Power Plant for Pre-Commissioning Validation
Testing of Coordinated Q-V Controller

Mais conteúdo relacionado

Mais procurados

WSN Based Temperature Monitoring System for Multiple Locations in Industry
WSN Based Temperature Monitoring System for Multiple Locations in IndustryWSN Based Temperature Monitoring System for Multiple Locations in Industry
WSN Based Temperature Monitoring System for Multiple Locations in Industryijtsrd
 
On line condition monitoring systems using wireless sensors and
On line condition monitoring systems using wireless sensors andOn line condition monitoring systems using wireless sensors and
On line condition monitoring systems using wireless sensors andMustafa Khan
 
BE Final Year CSE, ECE, EEE, IT, IS Projects,Bangalore
BE Final Year CSE, ECE, EEE, IT, IS Projects,BangaloreBE Final Year CSE, ECE, EEE, IT, IS Projects,Bangalore
BE Final Year CSE, ECE, EEE, IT, IS Projects,BangaloreIGEEKS TECHNOLOGIES
 
Maintain load balancing in wireless sensor networks using virtual grid based ...
Maintain load balancing in wireless sensor networks using virtual grid based ...Maintain load balancing in wireless sensor networks using virtual grid based ...
Maintain load balancing in wireless sensor networks using virtual grid based ...zaidinvisible
 
Security Robot
Security RobotSecurity Robot
Security Robotdiego5wh
 
Low cost energy-efficient smart monitoring system using open-source microcont...
Low cost energy-efficient smart monitoring system using open-source microcont...Low cost energy-efficient smart monitoring system using open-source microcont...
Low cost energy-efficient smart monitoring system using open-source microcont...zaidinvisible
 
Design and implementation smart home alarm system with zigbee transceiver
Design and implementation smart home alarm system with zigbee transceiverDesign and implementation smart home alarm system with zigbee transceiver
Design and implementation smart home alarm system with zigbee transceiverzaidinvisible
 
Low cost smart weather station using Arduino and ZigBee
Low cost smart weather station using Arduino and ZigBeeLow cost smart weather station using Arduino and ZigBee
Low cost smart weather station using Arduino and ZigBeeTELKOMNIKA JOURNAL
 
Project ideas ece students
Project ideas ece studentsProject ideas ece students
Project ideas ece studentsVatsal N Shah
 

Mais procurados (13)

WSN Based Temperature Monitoring System for Multiple Locations in Industry
WSN Based Temperature Monitoring System for Multiple Locations in IndustryWSN Based Temperature Monitoring System for Multiple Locations in Industry
WSN Based Temperature Monitoring System for Multiple Locations in Industry
 
On line condition monitoring systems using wireless sensors and
On line condition monitoring systems using wireless sensors andOn line condition monitoring systems using wireless sensors and
On line condition monitoring systems using wireless sensors and
 
BE Final Year CSE, ECE, EEE, IT, IS Projects,Bangalore
BE Final Year CSE, ECE, EEE, IT, IS Projects,BangaloreBE Final Year CSE, ECE, EEE, IT, IS Projects,Bangalore
BE Final Year CSE, ECE, EEE, IT, IS Projects,Bangalore
 
Maintain load balancing in wireless sensor networks using virtual grid based ...
Maintain load balancing in wireless sensor networks using virtual grid based ...Maintain load balancing in wireless sensor networks using virtual grid based ...
Maintain load balancing in wireless sensor networks using virtual grid based ...
 
Embedded 2015
Embedded 2015Embedded 2015
Embedded 2015
 
Milinia booklet
Milinia bookletMilinia booklet
Milinia booklet
 
Security Robot
Security RobotSecurity Robot
Security Robot
 
Embedded list
Embedded listEmbedded list
Embedded list
 
Low cost energy-efficient smart monitoring system using open-source microcont...
Low cost energy-efficient smart monitoring system using open-source microcont...Low cost energy-efficient smart monitoring system using open-source microcont...
Low cost energy-efficient smart monitoring system using open-source microcont...
 
Design and implementation smart home alarm system with zigbee transceiver
Design and implementation smart home alarm system with zigbee transceiverDesign and implementation smart home alarm system with zigbee transceiver
Design and implementation smart home alarm system with zigbee transceiver
 
Low cost smart weather station using Arduino and ZigBee
Low cost smart weather station using Arduino and ZigBeeLow cost smart weather station using Arduino and ZigBee
Low cost smart weather station using Arduino and ZigBee
 
Project ideas ece students
Project ideas ece studentsProject ideas ece students
Project ideas ece students
 
Wireless intelligent controller
Wireless intelligent controllerWireless intelligent controller
Wireless intelligent controller
 

Destaque

Презентация для родителей
Презентация для родителейПрезентация для родителей
Презентация для родителейmtetelev
 
RUBRICA ESTUDIANTES
RUBRICA ESTUDIANTESRUBRICA ESTUDIANTES
RUBRICA ESTUDIANTESmcllanosm
 
Onwednesdayswewearpinkfinal
OnwednesdayswewearpinkfinalOnwednesdayswewearpinkfinal
Onwednesdayswewearpinkfinaltiffanymelo
 
Kraljevi generacija hrvatskog šaha - 2003. - mala, ali važna ispravka
Kraljevi generacija hrvatskog šaha -  2003. - mala, ali važna ispravkaKraljevi generacija hrvatskog šaha -  2003. - mala, ali važna ispravka
Kraljevi generacija hrvatskog šaha - 2003. - mala, ali važna ispravkaŠk Ivan Dvoržak
 
Media pembelajaran
Media pembelajaranMedia pembelajaran
Media pembelajaranMilza Milza
 
Pascual Prayerletter March 2015....
Pascual Prayerletter March 2015....Pascual Prayerletter March 2015....
Pascual Prayerletter March 2015....Jonathan Pascual
 
Millennials haiku deck
Millennials haiku deckMillennials haiku deck
Millennials haiku deck11aeh4
 
Finlight Research - Market Perspectives - Jun 2015
Finlight Research - Market Perspectives - Jun 2015Finlight Research - Market Perspectives - Jun 2015
Finlight Research - Market Perspectives - Jun 2015FinLight Research
 
Überwerke 2016 - Kaapeli
Überwerke 2016 - KaapeliÜberwerke 2016 - Kaapeli
Überwerke 2016 - KaapeliMads Helbo
 
Roles and Functions of Educational Technology in the 21st century Education
Roles and Functions of Educational Technology in the 21st century EducationRoles and Functions of Educational Technology in the 21st century Education
Roles and Functions of Educational Technology in the 21st century Educationdorothey tumulak
 
Sample paper gat
Sample paper gatSample paper gat
Sample paper gatAnas Khan
 
sols_print_enrolment_record
sols_print_enrolment_recordsols_print_enrolment_record
sols_print_enrolment_recordChen Zhao
 
2013 ieee matlab project titles
2013 ieee matlab project titles2013 ieee matlab project titles
2013 ieee matlab project titlesEcwaytechnoz
 
YouTube Tools To The Rescue - Tots & Technology 2015
YouTube Tools To The Rescue - Tots & Technology 2015YouTube Tools To The Rescue - Tots & Technology 2015
YouTube Tools To The Rescue - Tots & Technology 2015Diana Benner
 

Destaque (20)

Презентация для родителей
Презентация для родителейПрезентация для родителей
Презентация для родителей
 
RUBRICA ESTUDIANTES
RUBRICA ESTUDIANTESRUBRICA ESTUDIANTES
RUBRICA ESTUDIANTES
 
Onwednesdayswewearpinkfinal
OnwednesdayswewearpinkfinalOnwednesdayswewearpinkfinal
Onwednesdayswewearpinkfinal
 
Nebosh IGC
Nebosh IGCNebosh IGC
Nebosh IGC
 
Kraljevi generacija hrvatskog šaha - 2003. - mala, ali važna ispravka
Kraljevi generacija hrvatskog šaha -  2003. - mala, ali važna ispravkaKraljevi generacija hrvatskog šaha -  2003. - mala, ali važna ispravka
Kraljevi generacija hrvatskog šaha - 2003. - mala, ali važna ispravka
 
Business Intelligence
Business IntelligenceBusiness Intelligence
Business Intelligence
 
Media pembelajaran
Media pembelajaranMedia pembelajaran
Media pembelajaran
 
Pascual Prayerletter March 2015....
Pascual Prayerletter March 2015....Pascual Prayerletter March 2015....
Pascual Prayerletter March 2015....
 
Millennials haiku deck
Millennials haiku deckMillennials haiku deck
Millennials haiku deck
 
EXERCISE IS MEDICINE - final
EXERCISE IS MEDICINE - finalEXERCISE IS MEDICINE - final
EXERCISE IS MEDICINE - final
 
Finlight Research - Market Perspectives - Jun 2015
Finlight Research - Market Perspectives - Jun 2015Finlight Research - Market Perspectives - Jun 2015
Finlight Research - Market Perspectives - Jun 2015
 
Überwerke 2016 - Kaapeli
Überwerke 2016 - KaapeliÜberwerke 2016 - Kaapeli
Überwerke 2016 - Kaapeli
 
Roles and Functions of Educational Technology in the 21st century Education
Roles and Functions of Educational Technology in the 21st century EducationRoles and Functions of Educational Technology in the 21st century Education
Roles and Functions of Educational Technology in the 21st century Education
 
Sample paper gat
Sample paper gatSample paper gat
Sample paper gat
 
sols_print_enrolment_record
sols_print_enrolment_recordsols_print_enrolment_record
sols_print_enrolment_record
 
Russia
RussiaRussia
Russia
 
Answer keys
Answer keysAnswer keys
Answer keys
 
2013 ieee matlab project titles
2013 ieee matlab project titles2013 ieee matlab project titles
2013 ieee matlab project titles
 
Untitled Presentation
Untitled PresentationUntitled Presentation
Untitled Presentation
 
YouTube Tools To The Rescue - Tots & Technology 2015
YouTube Tools To The Rescue - Tots & Technology 2015YouTube Tools To The Rescue - Tots & Technology 2015
YouTube Tools To The Rescue - Tots & Technology 2015
 

Semelhante a 2013 ieee embedded projects

Be,me ieee 2015 16 electrical electronicscommunication,tce,bio medical,diplom...
Be,me ieee 2015 16 electrical electronicscommunication,tce,bio medical,diplom...Be,me ieee 2015 16 electrical electronicscommunication,tce,bio medical,diplom...
Be,me ieee 2015 16 electrical electronicscommunication,tce,bio medical,diplom...igeeks1234
 
M.tech ieee 2014 15 electrical&electronics&power electronics&vlsi
M.tech ieee 2014 15 electrical&electronics&power electronics&vlsiM.tech ieee 2014 15 electrical&electronics&power electronics&vlsi
M.tech ieee 2014 15 electrical&electronics&power electronics&vlsiIGEEKS TECHNOLOGIES
 
IEEE 2014 DIPLOMA(ECE,E&I,EEE,CS,IS) Projects Bangalore,IEEE DIPLOMA(ECE,E&I...
IEEE 2014 DIPLOMA(ECE,E&I,EEE,CS,IS) Projects Bangalore,IEEE  DIPLOMA(ECE,E&I...IEEE 2014 DIPLOMA(ECE,E&I,EEE,CS,IS) Projects Bangalore,IEEE  DIPLOMA(ECE,E&I...
IEEE 2014 DIPLOMA(ECE,E&I,EEE,CS,IS) Projects Bangalore,IEEE DIPLOMA(ECE,E&I...IGEEKS TECHNOLOGIES
 
Embedded M.Tech project titles
Embedded M.Tech project titlesEmbedded M.Tech project titles
Embedded M.Tech project titlessmartprotech
 
Embedded projects in chennai
Embedded projects in chennaiEmbedded projects in chennai
Embedded projects in chennaiPhoenix Systems
 
M.tech embedded systems Projects Titles
M.tech embedded systems Projects TitlesM.tech embedded systems Projects Titles
M.tech embedded systems Projects TitlesRK Embedded Solutions
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichyranjith kumar
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichyranjith kumar
 
Matlab project titles in trichy
Matlab project  titles in trichyMatlab project  titles in trichy
Matlab project titles in trichyranjith kumar
 
Matlab project titles in trichy
Matlab project  titles in trichyMatlab project  titles in trichy
Matlab project titles in trichyranjith kumar
 
Matlab project titles in trichy
Matlab project  titles in trichyMatlab project  titles in trichy
Matlab project titles in trichyranjith kumar
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichyranjith kumar
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichyranjith kumar
 
Matlab project titles in trichy
Matlab project  titles in trichyMatlab project  titles in trichy
Matlab project titles in trichyranjith kumar
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichyranjith kumar
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichyranjith kumar
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichyranjith kumar
 

Semelhante a 2013 ieee embedded projects (20)

Be,me ieee 2015 16 electrical electronicscommunication,tce,bio medical,diplom...
Be,me ieee 2015 16 electrical electronicscommunication,tce,bio medical,diplom...Be,me ieee 2015 16 electrical electronicscommunication,tce,bio medical,diplom...
Be,me ieee 2015 16 electrical electronicscommunication,tce,bio medical,diplom...
 
M.tech ieee 2014 15 electrical&electronics&power electronics&vlsi
M.tech ieee 2014 15 electrical&electronics&power electronics&vlsiM.tech ieee 2014 15 electrical&electronics&power electronics&vlsi
M.tech ieee 2014 15 electrical&electronics&power electronics&vlsi
 
IEEE 2014 DIPLOMA(ECE,E&I,EEE,CS,IS) Projects Bangalore,IEEE DIPLOMA(ECE,E&I...
IEEE 2014 DIPLOMA(ECE,E&I,EEE,CS,IS) Projects Bangalore,IEEE  DIPLOMA(ECE,E&I...IEEE 2014 DIPLOMA(ECE,E&I,EEE,CS,IS) Projects Bangalore,IEEE  DIPLOMA(ECE,E&I...
IEEE 2014 DIPLOMA(ECE,E&I,EEE,CS,IS) Projects Bangalore,IEEE DIPLOMA(ECE,E&I...
 
ECE projects in chennai
ECE projects in chennaiECE projects in chennai
ECE projects in chennai
 
Embedded M.Tech project titles
Embedded M.Tech project titlesEmbedded M.Tech project titles
Embedded M.Tech project titles
 
Embedded projects in chennai
Embedded projects in chennaiEmbedded projects in chennai
Embedded projects in chennai
 
Topics
TopicsTopics
Topics
 
Me electronics projects
Me electronics projectsMe electronics projects
Me electronics projects
 
M.tech embedded systems Projects Titles
M.tech embedded systems Projects TitlesM.tech embedded systems Projects Titles
M.tech embedded systems Projects Titles
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichy
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichy
 
Matlab project titles in trichy
Matlab project  titles in trichyMatlab project  titles in trichy
Matlab project titles in trichy
 
Matlab project titles in trichy
Matlab project  titles in trichyMatlab project  titles in trichy
Matlab project titles in trichy
 
Matlab project titles in trichy
Matlab project  titles in trichyMatlab project  titles in trichy
Matlab project titles in trichy
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichy
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichy
 
Matlab project titles in trichy
Matlab project  titles in trichyMatlab project  titles in trichy
Matlab project titles in trichy
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichy
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichy
 
Projects on embbedded systems in trichy
Projects on embbedded systems in trichyProjects on embbedded systems in trichy
Projects on embbedded systems in trichy
 

Mais de Ecwaytechnoz

Wheelztracker.pptx
Wheelztracker.pptxWheelztracker.pptx
Wheelztracker.pptxEcwaytechnoz
 
Coloring based inter-wban scheduling for mobile wireless body area networks
Coloring based inter-wban scheduling for mobile wireless body area networksColoring based inter-wban scheduling for mobile wireless body area networks
Coloring based inter-wban scheduling for mobile wireless body area networksEcwaytechnoz
 
Code modulation based encryption & decryption technique for secure communicat...
Code modulation based encryption & decryption technique for secure communicat...Code modulation based encryption & decryption technique for secure communicat...
Code modulation based encryption & decryption technique for secure communicat...Ecwaytechnoz
 
Clustering sentence level text using a novel fuzzy relational clustering algo...
Clustering sentence level text using a novel fuzzy relational clustering algo...Clustering sentence level text using a novel fuzzy relational clustering algo...
Clustering sentence level text using a novel fuzzy relational clustering algo...Ecwaytechnoz
 
Clustering large probabilistic graphs
Clustering large probabilistic graphsClustering large probabilistic graphs
Clustering large probabilistic graphsEcwaytechnoz
 
Cloudsim t-drive enhancing driving directions with taxi drivers’ intelligence
Cloudsim  t-drive enhancing driving directions with taxi drivers’ intelligenceCloudsim  t-drive enhancing driving directions with taxi drivers’ intelligence
Cloudsim t-drive enhancing driving directions with taxi drivers’ intelligenceEcwaytechnoz
 
Cloudsim ranking on data manifold with sink points
Cloudsim  ranking on data manifold with sink pointsCloudsim  ranking on data manifold with sink points
Cloudsim ranking on data manifold with sink pointsEcwaytechnoz
 
Cloudsim quality-differentiated video multicast in multirate wireless networks
Cloudsim  quality-differentiated video multicast in multirate wireless networksCloudsim  quality-differentiated video multicast in multirate wireless networks
Cloudsim quality-differentiated video multicast in multirate wireless networksEcwaytechnoz
 
Cloudsim power allocation for statistical qo s provisioning in opportunistic...
Cloudsim  power allocation for statistical qo s provisioning in opportunistic...Cloudsim  power allocation for statistical qo s provisioning in opportunistic...
Cloudsim power allocation for statistical qo s provisioning in opportunistic...Ecwaytechnoz
 
Cloudsim distributed web systems performance forecasting using turning bands...
Cloudsim  distributed web systems performance forecasting using turning bands...Cloudsim  distributed web systems performance forecasting using turning bands...
Cloudsim distributed web systems performance forecasting using turning bands...Ecwaytechnoz
 
Cloudsim distributed processing of probabilistic top-k queries in wireless s...
Cloudsim  distributed processing of probabilistic top-k queries in wireless s...Cloudsim  distributed processing of probabilistic top-k queries in wireless s...
Cloudsim distributed processing of probabilistic top-k queries in wireless s...Ecwaytechnoz
 
Chopper based dc motor speed control
Chopper based dc motor speed controlChopper based dc motor speed control
Chopper based dc motor speed controlEcwaytechnoz
 
Channel assignment for throughput optimization in multichannel multiradio wir...
Channel assignment for throughput optimization in multichannel multiradio wir...Channel assignment for throughput optimization in multichannel multiradio wir...
Channel assignment for throughput optimization in multichannel multiradio wir...Ecwaytechnoz
 
Channel allocation and routing in hybrid multichannel multiradio wireless mes...
Channel allocation and routing in hybrid multichannel multiradio wireless mes...Channel allocation and routing in hybrid multichannel multiradio wireless mes...
Channel allocation and routing in hybrid multichannel multiradio wireless mes...Ecwaytechnoz
 
Casual stereoscopic photo authoring
Casual stereoscopic photo authoringCasual stereoscopic photo authoring
Casual stereoscopic photo authoringEcwaytechnoz
 
Casual stereoscopic photo authoring
Casual stereoscopic photo authoringCasual stereoscopic photo authoring
Casual stereoscopic photo authoringEcwaytechnoz
 
Capacity of hybrid wireless mesh networks with random a ps
Capacity of hybrid wireless mesh networks with random a psCapacity of hybrid wireless mesh networks with random a ps
Capacity of hybrid wireless mesh networks with random a psEcwaytechnoz
 
Bomb detection robot with wireless camera
Bomb detection robot with wireless cameraBomb detection robot with wireless camera
Bomb detection robot with wireless cameraEcwaytechnoz
 
Bed side patients monitoring system with emergency alert
Bed side patients monitoring system with  emergency alertBed side patients monitoring system with  emergency alert
Bed side patients monitoring system with emergency alertEcwaytechnoz
 

Mais de Ecwaytechnoz (20)

Wheelztracker.pptx
Wheelztracker.pptxWheelztracker.pptx
Wheelztracker.pptx
 
Coloring based inter-wban scheduling for mobile wireless body area networks
Coloring based inter-wban scheduling for mobile wireless body area networksColoring based inter-wban scheduling for mobile wireless body area networks
Coloring based inter-wban scheduling for mobile wireless body area networks
 
Code modulation based encryption & decryption technique for secure communicat...
Code modulation based encryption & decryption technique for secure communicat...Code modulation based encryption & decryption technique for secure communicat...
Code modulation based encryption & decryption technique for secure communicat...
 
Clustering sentence level text using a novel fuzzy relational clustering algo...
Clustering sentence level text using a novel fuzzy relational clustering algo...Clustering sentence level text using a novel fuzzy relational clustering algo...
Clustering sentence level text using a novel fuzzy relational clustering algo...
 
Clustering large probabilistic graphs
Clustering large probabilistic graphsClustering large probabilistic graphs
Clustering large probabilistic graphs
 
Cloudsim t-drive enhancing driving directions with taxi drivers’ intelligence
Cloudsim  t-drive enhancing driving directions with taxi drivers’ intelligenceCloudsim  t-drive enhancing driving directions with taxi drivers’ intelligence
Cloudsim t-drive enhancing driving directions with taxi drivers’ intelligence
 
Cloudsim ranking on data manifold with sink points
Cloudsim  ranking on data manifold with sink pointsCloudsim  ranking on data manifold with sink points
Cloudsim ranking on data manifold with sink points
 
Cloudsim quality-differentiated video multicast in multirate wireless networks
Cloudsim  quality-differentiated video multicast in multirate wireless networksCloudsim  quality-differentiated video multicast in multirate wireless networks
Cloudsim quality-differentiated video multicast in multirate wireless networks
 
Cloudsim power allocation for statistical qo s provisioning in opportunistic...
Cloudsim  power allocation for statistical qo s provisioning in opportunistic...Cloudsim  power allocation for statistical qo s provisioning in opportunistic...
Cloudsim power allocation for statistical qo s provisioning in opportunistic...
 
Cloudsim distributed web systems performance forecasting using turning bands...
Cloudsim  distributed web systems performance forecasting using turning bands...Cloudsim  distributed web systems performance forecasting using turning bands...
Cloudsim distributed web systems performance forecasting using turning bands...
 
Cloudsim distributed processing of probabilistic top-k queries in wireless s...
Cloudsim  distributed processing of probabilistic top-k queries in wireless s...Cloudsim  distributed processing of probabilistic top-k queries in wireless s...
Cloudsim distributed processing of probabilistic top-k queries in wireless s...
 
Civil 2013 titles
Civil 2013 titlesCivil 2013 titles
Civil 2013 titles
 
Chopper based dc motor speed control
Chopper based dc motor speed controlChopper based dc motor speed control
Chopper based dc motor speed control
 
Channel assignment for throughput optimization in multichannel multiradio wir...
Channel assignment for throughput optimization in multichannel multiradio wir...Channel assignment for throughput optimization in multichannel multiradio wir...
Channel assignment for throughput optimization in multichannel multiradio wir...
 
Channel allocation and routing in hybrid multichannel multiradio wireless mes...
Channel allocation and routing in hybrid multichannel multiradio wireless mes...Channel allocation and routing in hybrid multichannel multiradio wireless mes...
Channel allocation and routing in hybrid multichannel multiradio wireless mes...
 
Casual stereoscopic photo authoring
Casual stereoscopic photo authoringCasual stereoscopic photo authoring
Casual stereoscopic photo authoring
 
Casual stereoscopic photo authoring
Casual stereoscopic photo authoringCasual stereoscopic photo authoring
Casual stereoscopic photo authoring
 
Capacity of hybrid wireless mesh networks with random a ps
Capacity of hybrid wireless mesh networks with random a psCapacity of hybrid wireless mesh networks with random a ps
Capacity of hybrid wireless mesh networks with random a ps
 
Bomb detection robot with wireless camera
Bomb detection robot with wireless cameraBomb detection robot with wireless camera
Bomb detection robot with wireless camera
 
Bed side patients monitoring system with emergency alert
Bed side patients monitoring system with  emergency alertBed side patients monitoring system with  emergency alert
Bed side patients monitoring system with emergency alert
 

Último

Benefits Of Flutter Compared To Other Frameworks
Benefits Of Flutter Compared To Other FrameworksBenefits Of Flutter Compared To Other Frameworks
Benefits Of Flutter Compared To Other FrameworksSoftradix Technologies
 
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 3652toLead Limited
 
Salesforce Community Group Quito, Salesforce 101
Salesforce Community Group Quito, Salesforce 101Salesforce Community Group Quito, Salesforce 101
Salesforce Community Group Quito, Salesforce 101Paola De la Torre
 
08448380779 Call Girls In Friends Colony Women Seeking Men
08448380779 Call Girls In Friends Colony Women Seeking Men08448380779 Call Girls In Friends Colony Women Seeking Men
08448380779 Call Girls In Friends Colony Women Seeking MenDelhi Call girls
 
How to convert PDF to text with Nanonets
How to convert PDF to text with NanonetsHow to convert PDF to text with Nanonets
How to convert PDF to text with Nanonetsnaman860154
 
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure service
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure serviceWhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure service
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure servicePooja Nehwal
 
Key Features Of Token Development (1).pptx
Key  Features Of Token  Development (1).pptxKey  Features Of Token  Development (1).pptx
Key Features Of Token Development (1).pptxLBM Solutions
 
SIEMENS: RAPUNZEL – A Tale About Knowledge Graph
SIEMENS: RAPUNZEL – A Tale About Knowledge GraphSIEMENS: RAPUNZEL – A Tale About Knowledge Graph
SIEMENS: RAPUNZEL – A Tale About Knowledge GraphNeo4j
 
Presentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreterPresentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreternaman860154
 
Slack Application Development 101 Slides
Slack Application Development 101 SlidesSlack Application Development 101 Slides
Slack Application Development 101 Slidespraypatel2
 
Pigging Solutions in Pet Food Manufacturing
Pigging Solutions in Pet Food ManufacturingPigging Solutions in Pet Food Manufacturing
Pigging Solutions in Pet Food ManufacturingPigging Solutions
 
Human Factors of XR: Using Human Factors to Design XR Systems
Human Factors of XR: Using Human Factors to Design XR SystemsHuman Factors of XR: Using Human Factors to Design XR Systems
Human Factors of XR: Using Human Factors to Design XR SystemsMark Billinghurst
 
Scaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organizationScaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organizationRadu Cotescu
 
Unblocking The Main Thread Solving ANRs and Frozen Frames
Unblocking The Main Thread Solving ANRs and Frozen FramesUnblocking The Main Thread Solving ANRs and Frozen Frames
Unblocking The Main Thread Solving ANRs and Frozen FramesSinan KOZAK
 
The Codex of Business Writing Software for Real-World Solutions 2.pptx
The Codex of Business Writing Software for Real-World Solutions 2.pptxThe Codex of Business Writing Software for Real-World Solutions 2.pptx
The Codex of Business Writing Software for Real-World Solutions 2.pptxMalak Abu Hammad
 
Transforming Data Streams with Kafka Connect: An Introduction to Single Messa...
Transforming Data Streams with Kafka Connect: An Introduction to Single Messa...Transforming Data Streams with Kafka Connect: An Introduction to Single Messa...
Transforming Data Streams with Kafka Connect: An Introduction to Single Messa...HostedbyConfluent
 
Integration and Automation in Practice: CI/CD in Mule Integration and Automat...
Integration and Automation in Practice: CI/CD in Mule Integration and Automat...Integration and Automation in Practice: CI/CD in Mule Integration and Automat...
Integration and Automation in Practice: CI/CD in Mule Integration and Automat...Patryk Bandurski
 
Beyond Boundaries: Leveraging No-Code Solutions for Industry Innovation
Beyond Boundaries: Leveraging No-Code Solutions for Industry InnovationBeyond Boundaries: Leveraging No-Code Solutions for Industry Innovation
Beyond Boundaries: Leveraging No-Code Solutions for Industry InnovationSafe Software
 
Handwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed textsHandwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed textsMaria Levchenko
 
Understanding the Laravel MVC Architecture
Understanding the Laravel MVC ArchitectureUnderstanding the Laravel MVC Architecture
Understanding the Laravel MVC ArchitecturePixlogix Infotech
 

Último (20)

Benefits Of Flutter Compared To Other Frameworks
Benefits Of Flutter Compared To Other FrameworksBenefits Of Flutter Compared To Other Frameworks
Benefits Of Flutter Compared To Other Frameworks
 
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365
 
Salesforce Community Group Quito, Salesforce 101
Salesforce Community Group Quito, Salesforce 101Salesforce Community Group Quito, Salesforce 101
Salesforce Community Group Quito, Salesforce 101
 
08448380779 Call Girls In Friends Colony Women Seeking Men
08448380779 Call Girls In Friends Colony Women Seeking Men08448380779 Call Girls In Friends Colony Women Seeking Men
08448380779 Call Girls In Friends Colony Women Seeking Men
 
How to convert PDF to text with Nanonets
How to convert PDF to text with NanonetsHow to convert PDF to text with Nanonets
How to convert PDF to text with Nanonets
 
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure service
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure serviceWhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure service
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure service
 
Key Features Of Token Development (1).pptx
Key  Features Of Token  Development (1).pptxKey  Features Of Token  Development (1).pptx
Key Features Of Token Development (1).pptx
 
SIEMENS: RAPUNZEL – A Tale About Knowledge Graph
SIEMENS: RAPUNZEL – A Tale About Knowledge GraphSIEMENS: RAPUNZEL – A Tale About Knowledge Graph
SIEMENS: RAPUNZEL – A Tale About Knowledge Graph
 
Presentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreterPresentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreter
 
Slack Application Development 101 Slides
Slack Application Development 101 SlidesSlack Application Development 101 Slides
Slack Application Development 101 Slides
 
Pigging Solutions in Pet Food Manufacturing
Pigging Solutions in Pet Food ManufacturingPigging Solutions in Pet Food Manufacturing
Pigging Solutions in Pet Food Manufacturing
 
Human Factors of XR: Using Human Factors to Design XR Systems
Human Factors of XR: Using Human Factors to Design XR SystemsHuman Factors of XR: Using Human Factors to Design XR Systems
Human Factors of XR: Using Human Factors to Design XR Systems
 
Scaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organizationScaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organization
 
Unblocking The Main Thread Solving ANRs and Frozen Frames
Unblocking The Main Thread Solving ANRs and Frozen FramesUnblocking The Main Thread Solving ANRs and Frozen Frames
Unblocking The Main Thread Solving ANRs and Frozen Frames
 
The Codex of Business Writing Software for Real-World Solutions 2.pptx
The Codex of Business Writing Software for Real-World Solutions 2.pptxThe Codex of Business Writing Software for Real-World Solutions 2.pptx
The Codex of Business Writing Software for Real-World Solutions 2.pptx
 
Transforming Data Streams with Kafka Connect: An Introduction to Single Messa...
Transforming Data Streams with Kafka Connect: An Introduction to Single Messa...Transforming Data Streams with Kafka Connect: An Introduction to Single Messa...
Transforming Data Streams with Kafka Connect: An Introduction to Single Messa...
 
Integration and Automation in Practice: CI/CD in Mule Integration and Automat...
Integration and Automation in Practice: CI/CD in Mule Integration and Automat...Integration and Automation in Practice: CI/CD in Mule Integration and Automat...
Integration and Automation in Practice: CI/CD in Mule Integration and Automat...
 
Beyond Boundaries: Leveraging No-Code Solutions for Industry Innovation
Beyond Boundaries: Leveraging No-Code Solutions for Industry InnovationBeyond Boundaries: Leveraging No-Code Solutions for Industry Innovation
Beyond Boundaries: Leveraging No-Code Solutions for Industry Innovation
 
Handwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed textsHandwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed texts
 
Understanding the Laravel MVC Architecture
Understanding the Laravel MVC ArchitectureUnderstanding the Laravel MVC Architecture
Understanding the Laravel MVC Architecture
 

2013 ieee embedded projects

  • 1. ECWAY TECHNOLOGIES IEEE PROJECTS & SOFTWARE DEVELOPMENTS OUR OFFICES @ CHENNAI / TRICHY / KARUR / ERODE / MADURAI / SALEM / COIMBATORE BANGALORE / HYDRABAD CELL: +91 98949 17187 | +91 875487 1111 / 2111 / 3111 / 4111 / 5111 / 6111 / 8111 VISIT: www.ecwayprojects.com Mailto: ecwaytechnologies@gmail.com IEEE EMBEDDED 2013-2014 1 A contest-oriented project for learning intelligent mobile robots 2 A low cost web based remote monitoring system with built-in security feature for vulnerable environments 3 A smart prepaid energy metering system to control electricity theft 4 Scaling Energy Per Operation via an Asynchronous Pipeline 5 A wearable inertial-sensing-based body sensor network for shoulder range of motion assessment 6 A wireless electrocardiogram detection for personal health monitoring 7 A ZIGBEE SMS alert system with trust mechanism in wireless sensor networks 8 A ZIGBEE-based wireless wearable electronic nose using flexible printed sensor array 9 An apparatus in monitoring the energy charging system 10 An embedded system for an EEG based BCI 11 Application of temperature compensated ultrasonic ranging for blind person and verification using Matlab 12 Automated control system for air pollution detection in vehicles 13 Automatic speed and torque monitoring in induction motors using ZIGBEE and SMS 14 Biomedical sensor network for cardiovascular fitness and activity monitoring 15 Building point of care health technologies on the IEEE 11073 health device standards 16 Capacitive seat sensors for multiple occupancy detection using a low-cost setup 17 Communication networks of domestic small-scale renewable energy systems 18 Coordinator traffic diffusion for data-intensive ZIGBEE transmission in real-time electrocardiography monitoring 19 Design and development of digital PID controller for dc motor drive system using embedded platform for mobile robot
  • 2. 20 Design and development of pic microcontroller based vehicle monitoring system using controller area network (can) protocol 21 Design and fabrication of a miniaturized ECG system with Bluetooth connectivity 22 Dynamic wireless sensor networks for real time safeguard of workers exposed to physical agents in constructions sites 23 Environment monitoring and device control using arm based embedded controlled sensor network 24 High-temperature uhf RFID sensor measurements in a full-metal environment 25 Human health monitoring mobile phone application by using the wireless Nano sensor based embedded system 26 Integrated design of efficient & reliable motor drive and PFC using low cost microcontroller with embedded PGA’s and CLA 27 Intelligent monitoring and control rendered to street lighting 28 Intelligent technologies for self-sustaining, RFID-based, rural e health systems 29 Introduction of electromagnetic image-based chip less RFID system 30 Low power wireless sensor network for building monitoring 31 Mobile robot localization using the phase of passive uhf-RFID signals 32 Multi-platform wireless measurement system for continuous bio-monitoring 33 Optimal angular movement of laser beam in SPR using an embedded controller 34 Passenger bus alert system for easy navigation of blind 35 Portable wireless biomedical temperature monitoring system: architecture and implementation 36 Power consumption in direct interface circuits 37 Remote-control system of high efficiency and intelligent street lighting using a ZIGBEE network of devices and sensors 38 RFID range extensions with low-power wireless edge devices 39 RFID-based digital content copy protection system in movie and audio rental agency 40 Smart host microcontroller for optimal battery charging in a solar-powered robotic vehicle 41 Solar powered water quality monitoring system using wireless sensor network 42 The ultrasonic distance alarm system based on msp430f449 43 Towards the implementation of IOT for environmental condition monitoring in homes 44 Water environment monitoring system based on ZIGBEE technology 45 Wireless access control system based on IEEE 802.15.4 46 Wireless sensor network for multi-storey building: design and implementation 47 ZIGBEE and atmega32 based wireless digital control and monitoring system for led lighting 48 Building point of care health technology on the IEEE 11073 health device standards 49 Monitoring of cigarette smoking using wearable sensors and support vector machines 50 A Low-Complexity Turbo Decoder Architecture for Energy-Efficient Wireless Sensor Networks 51 Scaling Energy Per Operation via an Asynchronous Pipeline
  • 3. 52 ROBOTICS- Covering Points of Interest with Mobile Sensors 53 Concurrent Multiresource Arbiter Design and Applications 54 Distributed Multiple ConstraintsGeneralizedSidelobe Canceler for Fully Connected Wireless Acoustic Sensor Networks 55 Exponential and Power Law Distribution of Contact Duration in Urban Vehicular Ad Hoc Networks 56 On the Reconstruction of Quad-Pol SAR Data From Compact Polarimetry Data For Ocean Target Detection 58 Pragmatic Integration of an SRAM Row Cache in Heterogeneous 3-D DRAM Architecture Using TSV 59 Real-Time Implementation of the Vertex Component Analysis Algorithm on GPUs 60 Real-Time IO Management System with COTS Peripherals IEEE 2013 IMAGE PROCESSING 1 Optical flow estimation for flame detection in videos 2 Image sharpness assessment based on local phase coherence 3 Structural texture similarity metrics for image analysis and retrieval 4 Dimensionality reduction for registration of high-dimensional data sets 5 Exploring visual and motion saliency for automatic video object extraction 6 Image in-painting on the basis of spectral structure from 2-d non-harmonic analysis 7 Efficient minimum error bounded particle re-sampling l1 tracker with occlusion detection 8 GPU accelerated edge-region based level set evolution constrained by 2d gray-scale histogram 9 Recursive histogram modification: establishing equivalency between reversible data hiding and lossless data compression 10 Integration of Gibbs Markova random field and Hopfield-type neural networks for unsupervised change detection in remotely sensed multi-temporal images IEEE 2013 COMMUNICATIONS 1 Blind symbol timing and CFO estimation for OFDM/OQAM systems 2 A peak power efficient cooperative diversity using STAR-QAM with coherent/non-coherent detection 3 On the effect of outdated channel estimation in variable gain relaying: error performance and PAPR 4 Decoding and performance bound of demodulate-and-forward based distributed ALAMOUTI STBC 2013 IEEE PROJECT TITLES *** [PLC] 1. A Comprehensive Solution for Deterministic Replay Debugging of SoftPLC Applications 2. Power-Line Communication in Medium- Voltage System: Simulation Model and Onfield Experimental Tests
  • 4. 3. Methods for Reliable Simulation-Based PLC Code Verification 4. Performance of HTTP Protocol in Networked Control Systems 5. Oil-Filled MV/LV Power-Transformer Behavior in Narrow-Band Power-Line Communication Systems 6. A Time-Domain Model of Background Noise for In-Home MIMO PLC Networks 7. Automatic Generation of the Supervisor Code for Industrial Switched-Mode Systems 8. Dealing With Unknown Impedance and Impulsive Noise in the Power-Line Communications Channel 9. Development of PLC-based software for increasing the dependability of production automation systems 10. Multi-DSP and -FPGA-Based Fully Digital Control System for Cascaded Multilevel Converters Used in FACTS Applications 11. PLC-Based Model of Reactive Power Flow in Steam Power Plant for Pre-Commissioning Validation Testing of Coordinated Q-V Controller