SlideShare uma empresa Scribd logo
1 de 32
Baixar para ler offline
ChemAxon UGM, Budapest
20/05/2015
SureChEMBL: Open Patent Data
George Papadatos, PhD
ChEMBL Group, EMBL-EBI
georgep@ebi.ac.uk
EMBL-EBI Resources Genes, genomes & variation
ArrayExpress Expression Atlas PRIDE
InterPro Pfam UniProt
ChEMBL ChEBI
Literature &
ontologies
Europe PubMed Central
Gene Ontology
Experimental Factor
Ontology
Molecular structures
Protein Data Bank in Europe
Electron Microscopy Data Bank
European Nucleotide
Archive
1000 Genomes
Gene, protein & metabolite expression
Protein sequences, families & motifs
Chemical biology
Reactions, interactions &
pathways
IntAct Reactome MetaboLights
Systems
BioModels
Enzyme Portal
BioSamples
Ensembl
Ensembl Genomes
European Genome-phenome Archive
Metagenomics portal
Bioactivity data
Compound
Assay/Target
>Thrombin
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLE
RECVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGT
NYRGHVNITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYT
TDPTVRRQECSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVT
THGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGY
CDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLF
EKKSLEDKTERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDR
WVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWR
ENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTA
NVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE
3. Insight, tools and resources for translational drug discovery
2. Organization, integration, curation and standardization of pharmacology data
1. Scientific facts
Ki = 4.5nM
APTT = 11 min.
ChEMBL: Data for drug discovery
Why looking at patent documents?
• Patent filing and searching
• Legal, financial and commercial incentives & interests
• Prior art, novelty, freedom to operate searches
• Competitive intelligence
• Unprecedented wealth of knowledge
• Most of knowledge will never be disclosed anywhere else
• Average lag of 2-3 years between patent document and journal
publication disclosure for chemistry
From SureChem to SureChEMBL
• Digital Science/Macmillan donated SureChem to EMBL-
EBI
• SureChem: commercial patent chemistry mining product
• Wellcome Trust funds further development
• EMBL-EBI provides an on-going, live service
• Full functionality freely available to everyone
• Query, view and export chemistry from patents
• Complemented with biological annotations
SureChEMBL data processing
WO
EP
Applications
& Granted
US
Applications
& granted
JP
Abstracts
Patent
Offices
Chemistry
Database
SureChEMBL System
Patent
PDFs
(service)
Application
Users
API
Database
Entity
Recognition
SureChem IP
1-[4-ethoxy-3-(6,7-dihydro-1-methyl-7-oxo-3-propyl-
1H-pyrazolo[4,3-d]pyrimidin-5-yl)phenylsulfonyl]-4-
methylpiperazine
Image to
Structure
(one method)
Name to
Structure
(five methods)
OCR
Processed
patents
(service)
SureChEMBL data processing
WO
EP
Applications
& Granted
US
Applications
& granted
JP
Abstracts
Patent
Offices
Chemistry
Database
SureChEMBL System
Patent
PDFs
(service)
Application
Users
API
Database
Entity
Recognition
SureChem IP
1-[4-ethoxy-3-(6,7-dihydro-1-methyl-7-oxo-3-propyl-
1H-pyrazolo[4,3-d]pyrimidin-5-yl)phenylsulfonyl]-4-
methylpiperazine
Image to
Structure
(one method)
Name to
Structure
(five methods)
OCR
Processed
patents
(service)
Homepage
Help
Search by keyword and
meta-data
Search by
chemical
structure
(sketch
compound)
Search by
SMILES, MOL,
SMARTS, name
Search by patent number
Filter by authority
(US, EP, WO and JP)
Filter by document section
(title, claims, abstract,
description and images)
Chemical
search type
(substructure,
similarity,
identical) Filter
by date
Filter by MW
www.surechembl.org
Data growth
• ~80K novel compounds every month
• ~800K novel compounds since EBI took over
• 2–7 days for a published patent to be chemically annotated and
searchable in SureChEMBL
Cumulative growth of SureChEMBL compounds
Compoundcount
Time
EMBL-EBI chemistry resources
RDF and REST API interfaces
REST API Interface - https://www.ebi.ac.uk/unichem/
Atlas
Ligand
induced
transcript
response
750
PDBe
Ligand
structures
from
protein
complexes
15K
ChEBI
Nomenclature
of primary and
secondary
metabolites.
Chemical
Ontology
24K
SureChEMBL
Chemical
structures
from patent
literature
16M
ChEMBL
Bioactivity
data from
literature
and
depositions
1.5M
UniChem – InChI-based chemical resolver (full + relaxed ‘lenses’) >90M
3rd Party Data
ZINC, PubChem,
ThomsonPharma
DOTF, IUPHAR,
DrugBank, KEGG,
NIH NCC,
eMolecules, FDA
SRS, PharmGKB,
Selleck, ….
~65M
Data access & exports
• Full compound repository
• FTP download, SDF and CSV format
• Updates quarterly
• Full compound-patent map
• FTP download, flat file
• Updates quarterly
• Data feed client
• Creates a local replica database of SureChEMBL
• Updates daily
Compound-patent map
• Flat file with
• Compound, global frequency, document, section, section
frequency, publication date
• Back file
• 187,958,584 unique patent-compound pairs
• 14,076,090 unique compound IDs
• 3,585,233 EP, JP, WO and US patent docs
• 1960-2014
• Quarterly incremental updates
• Q1 2015 is also now available on the FTP
http://chembl.blogspot.co.uk/2015/03/the-surechembl-map-file-is-out.html
Data feed client
http://vartree.blogspot.co.uk/2015/01/how-to-create-your-own-replica-of.html
Use cases with SureChEMBL
• Chemoinformatics
• Chemistry landscape for a particular biological target/disease
• Novel chemistry & scaffolds
• MDS, MCS and R-group analysis for a particular patent family claimed
chemistry
• (Negative) novelty checking with UniChem
• Competitive intelligence
• Reporting
• Patent alerts
• Per target/disease/company
Bioactivity data extraction? Compounds
Target/Assay
Bioactivity
Markush structure extraction?
-alkyl
-aryl
-heteroaryl
-heterocyclyl
-cycloalkyl
….
Biological annotations
Bioannotations soon to be integrated into SureChEMBL interface –
using SciBite’s Termite text mining engine
US-9012636-B2
Future steps
• OpenPHACTS ENSO
• Biological tagging of targets, genes, indications and diseases
• Development of integrated use-cases
• Combine chemistry & biology from patents, literature, pathways, etc.
• OpenPHACTS API
• Accessible via KNIME nodes
• Further improvements/added value
• Data quality and accuracy
• Target and compound relevance score
Acknowledgements
ChEMBL team:
• John Overington
• Anne Hersey
• Anna Gaulton
• Mark Davies
• Nathan Dedman
• Michal Nowotka
Collaborators:
• James Siddle
• Richard Koks
• Lee Harland
• Kevin Clark
Support:
surechembl-help@ebi.ac.uk
Webinar:
http://www.ebi.ac.uk/training/online/course/surechembl-accessing-chemical-patent-data-webinar
Technology partners
ChemAxon UGM, Budapest
20/05/2015
SureChEMBL: Open Patent Data
George Papadatos, PhD
ChEMBL Group, EMBL-EBI
georgep@ebi.ac.uk
Back-up slides
• Connectivity match on single components - UniChem
ChEMBL-SureChEMBL compound overlap
21.4%
SureChEMBL
ChEMBL
1.5M
16M
Too granular? Try scaffolds instead
Level 1 scaffold overlap
57%
SureChEMBLChEMBL
61K
298K
Level 1 scaffold overlap
57%
SureChEMBLChEMBL
61K
298K
Can we have everything?
Cost
TimeQuality
Common sources of errors
• Small, poor quality images
• OCR errors in names (OCR done by IFI). There is an OCR correction
step, but cannot fix all errors
-> ‘2,6-Difluoro-Λ/-{1 -r(4-iodo-2-methylphenyl)methvn-1 H-pyrazol-3-
vDbenzamide’
• Reliability better for US patents due to inclusion of mol files

Mais conteúdo relacionado

Mais procurados

ICIC 2014 From SureChem to SureChEMBL
ICIC 2014 From SureChem to SureChEMBLICIC 2014 From SureChem to SureChEMBL
ICIC 2014 From SureChem to SureChEMBLDr. Haxel Consult
 
PubChem and its application for cheminformatics education
PubChem and its application for cheminformatics educationPubChem and its application for cheminformatics education
PubChem and its application for cheminformatics educationSunghwan Kim
 
PubChem as a resource for chemical information training
PubChem as a resource for chemical information trainingPubChem as a resource for chemical information training
PubChem as a resource for chemical information trainingSunghwan Kim
 
Cheminformatics Education with PubChem
Cheminformatics Education with PubChemCheminformatics Education with PubChem
Cheminformatics Education with PubChemSunghwan Kim
 
Toxicological information in PubChem
Toxicological information in PubChemToxicological information in PubChem
Toxicological information in PubChemSunghwan Kim
 
PubChem for chemical information literacy training
PubChem for chemical information literacy trainingPubChem for chemical information literacy training
PubChem for chemical information literacy trainingSunghwan Kim
 
Exploiting PubChem for Drug Discovery
Exploiting PubChem for Drug DiscoveryExploiting PubChem for Drug Discovery
Exploiting PubChem for Drug DiscoverySunghwan Kim
 
PubChem and Its Applications for Drug Discovery
PubChem and Its Applications for Drug DiscoveryPubChem and Its Applications for Drug Discovery
PubChem and Its Applications for Drug DiscoverySunghwan Kim
 
CINF 55: SureChEMBL: An open patent chemistry resource
CINF 55: SureChEMBL: An open patent chemistry resourceCINF 55: SureChEMBL: An open patent chemistry resource
CINF 55: SureChEMBL: An open patent chemistry resourceGeorge Papadatos
 
PubChem: A Public Chemical Information Resource for Big Data Chemistry
PubChem: A Public Chemical Information Resource for Big Data ChemistryPubChem: A Public Chemical Information Resource for Big Data Chemistry
PubChem: A Public Chemical Information Resource for Big Data ChemistrySunghwan Kim
 
SureChEMBL and Open PHACTS
SureChEMBL and Open PHACTSSureChEMBL and Open PHACTS
SureChEMBL and Open PHACTSGeorge Papadatos
 

Mais procurados (20)

ICIC 2014 From SureChem to SureChEMBL
ICIC 2014 From SureChem to SureChEMBLICIC 2014 From SureChem to SureChEMBL
ICIC 2014 From SureChem to SureChEMBL
 
PubChem and its application for cheminformatics education
PubChem and its application for cheminformatics educationPubChem and its application for cheminformatics education
PubChem and its application for cheminformatics education
 
PubChem as a resource for chemical information training
PubChem as a resource for chemical information trainingPubChem as a resource for chemical information training
PubChem as a resource for chemical information training
 
Cheminformatics Education with PubChem
Cheminformatics Education with PubChemCheminformatics Education with PubChem
Cheminformatics Education with PubChem
 
Toxicological information in PubChem
Toxicological information in PubChemToxicological information in PubChem
Toxicological information in PubChem
 
PubChem for chemical information literacy training
PubChem for chemical information literacy trainingPubChem for chemical information literacy training
PubChem for chemical information literacy training
 
PFAS Chemistry: Range, Complexity, Groupings, and the CompTox Chemicals Dash...
PFAS Chemistry: Range, Complexity, Groupings, and the CompTox  Chemicals Dash...PFAS Chemistry: Range, Complexity, Groupings, and the CompTox  Chemicals Dash...
PFAS Chemistry: Range, Complexity, Groupings, and the CompTox Chemicals Dash...
 
Exploiting PubChem for Drug Discovery
Exploiting PubChem for Drug DiscoveryExploiting PubChem for Drug Discovery
Exploiting PubChem for Drug Discovery
 
How to place your research questions or results into the context of the "Lega...
How to place your research questions or results into the context of the "Lega...How to place your research questions or results into the context of the "Lega...
How to place your research questions or results into the context of the "Lega...
 
New Approach Methods - What is That?
New Approach Methods - What is That?New Approach Methods - What is That?
New Approach Methods - What is That?
 
TRIANGLE AREA MASS SPECTOMETRY MEETING: Structure Identification Approaches U...
TRIANGLE AREA MASS SPECTOMETRY MEETING: Structure Identification Approaches U...TRIANGLE AREA MASS SPECTOMETRY MEETING: Structure Identification Approaches U...
TRIANGLE AREA MASS SPECTOMETRY MEETING: Structure Identification Approaches U...
 
US-EPA Chemicals Dashboard – an integrated data hub for environmental science
US-EPA Chemicals Dashboard – an integrated data hub for environmental scienceUS-EPA Chemicals Dashboard – an integrated data hub for environmental science
US-EPA Chemicals Dashboard – an integrated data hub for environmental science
 
PubChem and Its Applications for Drug Discovery
PubChem and Its Applications for Drug DiscoveryPubChem and Its Applications for Drug Discovery
PubChem and Its Applications for Drug Discovery
 
CINF 55: SureChEMBL: An open patent chemistry resource
CINF 55: SureChEMBL: An open patent chemistry resourceCINF 55: SureChEMBL: An open patent chemistry resource
CINF 55: SureChEMBL: An open patent chemistry resource
 
Overview of SureChEMBL
Overview of SureChEMBLOverview of SureChEMBL
Overview of SureChEMBL
 
PubChem: A Public Chemical Information Resource for Big Data Chemistry
PubChem: A Public Chemical Information Resource for Big Data ChemistryPubChem: A Public Chemical Information Resource for Big Data Chemistry
PubChem: A Public Chemical Information Resource for Big Data Chemistry
 
SureChEMBL and Open PHACTS
SureChEMBL and Open PHACTSSureChEMBL and Open PHACTS
SureChEMBL and Open PHACTS
 
ChEMBL+KNIME
ChEMBL+KNIMEChEMBL+KNIME
ChEMBL+KNIME
 
Web-based access to data for >600 disinfection by-products via the EPA CompTo...
Web-based access to data for >600 disinfection by-products via the EPA CompTo...Web-based access to data for >600 disinfection by-products via the EPA CompTo...
Web-based access to data for >600 disinfection by-products via the EPA CompTo...
 
Does bigger mean better in the world of chemistry databases?
Does bigger mean better in the world of chemistry databases? Does bigger mean better in the world of chemistry databases?
Does bigger mean better in the world of chemistry databases?
 

Semelhante a EUGM15 - George Papadatos, Mark Davies, Nathan Dedman (EMBL-EBI): SureChEMBL: An Open Patent Chemistry Resource

2011-10-11 Open PHACTS at BioIT World Europe
2011-10-11 Open PHACTS at BioIT World Europe2011-10-11 Open PHACTS at BioIT World Europe
2011-10-11 Open PHACTS at BioIT World Europeopen_phacts
 
2011-11-28 Open PHACTS at RSC CICAG
2011-11-28 Open PHACTS at RSC CICAG2011-11-28 Open PHACTS at RSC CICAG
2011-11-28 Open PHACTS at RSC CICAGopen_phacts
 
OSFair2017 Workshop | OmicsDI: Omics discovery index
OSFair2017 Workshop | OmicsDI: Omics discovery indexOSFair2017 Workshop | OmicsDI: Omics discovery index
OSFair2017 Workshop | OmicsDI: Omics discovery indexOpen Science Fair
 
Quantifying the content of biomedical semantic resources as a core for drug d...
Quantifying the content of biomedical semantic resources as a core for drug d...Quantifying the content of biomedical semantic resources as a core for drug d...
Quantifying the content of biomedical semantic resources as a core for drug d...Syed Muhammad Ali Hasnain
 
Ontologies for life sciences: examples from the gene ontology
Ontologies for life sciences: examples from the gene ontologyOntologies for life sciences: examples from the gene ontology
Ontologies for life sciences: examples from the gene ontologyMelanie Courtot
 
EUGM 2014 - Mark Davies (EMBL-EBI): SureChEMBL – Open Patent Data
EUGM 2014 - Mark Davies (EMBL-EBI): SureChEMBL – Open Patent Data  EUGM 2014 - Mark Davies (EMBL-EBI): SureChEMBL – Open Patent Data
EUGM 2014 - Mark Davies (EMBL-EBI): SureChEMBL – Open Patent Data ChemAxon
 
2015-05-19 Open PHACTS Drug Discovery Workflow Workshop - The API
2015-05-19 Open PHACTS Drug Discovery Workflow Workshop - The API2015-05-19 Open PHACTS Drug Discovery Workflow Workshop - The API
2015-05-19 Open PHACTS Drug Discovery Workflow Workshop - The APIopen_phacts
 
Pasteur Institute User Story - Cheminfo Stories 2020 Day 5
Pasteur Institute User Story - Cheminfo Stories 2020 Day 5Pasteur Institute User Story - Cheminfo Stories 2020 Day 5
Pasteur Institute User Story - Cheminfo Stories 2020 Day 5ChemAxon
 
SAR_EMBL_EBI_EC_BLAST_NOV_2013_Industry_workshop
SAR_EMBL_EBI_EC_BLAST_NOV_2013_Industry_workshopSAR_EMBL_EBI_EC_BLAST_NOV_2013_Industry_workshop
SAR_EMBL_EBI_EC_BLAST_NOV_2013_Industry_workshopSyed Asad Rahman
 
Connecting life sciences data at the European Bioinformatics Institute
Connecting life sciences data at the European Bioinformatics InstituteConnecting life sciences data at the European Bioinformatics Institute
Connecting life sciences data at the European Bioinformatics InstituteConnected Data World
 

Semelhante a EUGM15 - George Papadatos, Mark Davies, Nathan Dedman (EMBL-EBI): SureChEMBL: An Open Patent Chemistry Resource (20)

2011-10-11 Open PHACTS at BioIT World Europe
2011-10-11 Open PHACTS at BioIT World Europe2011-10-11 Open PHACTS at BioIT World Europe
2011-10-11 Open PHACTS at BioIT World Europe
 
2011-11-28 Open PHACTS at RSC CICAG
2011-11-28 Open PHACTS at RSC CICAG2011-11-28 Open PHACTS at RSC CICAG
2011-11-28 Open PHACTS at RSC CICAG
 
Online Resources to Support Open Drug Discovery Systems
Online Resources to Support Open Drug Discovery SystemsOnline Resources to Support Open Drug Discovery Systems
Online Resources to Support Open Drug Discovery Systems
 
OSFair2017 Workshop | OmicsDI: Omics discovery index
OSFair2017 Workshop | OmicsDI: Omics discovery indexOSFair2017 Workshop | OmicsDI: Omics discovery index
OSFair2017 Workshop | OmicsDI: Omics discovery index
 
Quantifying the content of biomedical semantic resources as a core for drug d...
Quantifying the content of biomedical semantic resources as a core for drug d...Quantifying the content of biomedical semantic resources as a core for drug d...
Quantifying the content of biomedical semantic resources as a core for drug d...
 
Ontologies for life sciences: examples from the gene ontology
Ontologies for life sciences: examples from the gene ontologyOntologies for life sciences: examples from the gene ontology
Ontologies for life sciences: examples from the gene ontology
 
Sourcing high quality online data resources for computational toxicology
Sourcing high quality online data resources for computational toxicologySourcing high quality online data resources for computational toxicology
Sourcing high quality online data resources for computational toxicology
 
Serving the medicinal chemistry community with Royal Society of Chemistry che...
Serving the medicinal chemistry community with Royal Society of Chemistry che...Serving the medicinal chemistry community with Royal Society of Chemistry che...
Serving the medicinal chemistry community with Royal Society of Chemistry che...
 
EUGM 2014 - Mark Davies (EMBL-EBI): SureChEMBL – Open Patent Data
EUGM 2014 - Mark Davies (EMBL-EBI): SureChEMBL – Open Patent Data  EUGM 2014 - Mark Davies (EMBL-EBI): SureChEMBL – Open Patent Data
EUGM 2014 - Mark Davies (EMBL-EBI): SureChEMBL – Open Patent Data
 
Accessing Environmental Chemistry Data via Data Dashboards
Accessing Environmental Chemistry Data via Data Dashboards Accessing Environmental Chemistry Data via Data Dashboards
Accessing Environmental Chemistry Data via Data Dashboards
 
2015-05-19 Open PHACTS Drug Discovery Workflow Workshop - The API
2015-05-19 Open PHACTS Drug Discovery Workflow Workshop - The API2015-05-19 Open PHACTS Drug Discovery Workflow Workshop - The API
2015-05-19 Open PHACTS Drug Discovery Workflow Workshop - The API
 
The US-EPA CompTox Chemicals Dashboard – a key player in the domain of Open S...
The US-EPA CompTox Chemicals Dashboard – a key player in the domain of Open S...The US-EPA CompTox Chemicals Dashboard – a key player in the domain of Open S...
The US-EPA CompTox Chemicals Dashboard – a key player in the domain of Open S...
 
Pasteur Institute User Story - Cheminfo Stories 2020 Day 5
Pasteur Institute User Story - Cheminfo Stories 2020 Day 5Pasteur Institute User Story - Cheminfo Stories 2020 Day 5
Pasteur Institute User Story - Cheminfo Stories 2020 Day 5
 
Accessing information for Per- & Polyfluoroalkyl Substances using the US EPA ...
Accessing information for Per- & Polyfluoroalkyl Substances using the US EPA ...Accessing information for Per- & Polyfluoroalkyl Substances using the US EPA ...
Accessing information for Per- & Polyfluoroalkyl Substances using the US EPA ...
 
SAR_EMBL_EBI_EC_BLAST_NOV_2013_Industry_workshop
SAR_EMBL_EBI_EC_BLAST_NOV_2013_Industry_workshopSAR_EMBL_EBI_EC_BLAST_NOV_2013_Industry_workshop
SAR_EMBL_EBI_EC_BLAST_NOV_2013_Industry_workshop
 
Connecting life sciences data at the European Bioinformatics Institute
Connecting life sciences data at the European Bioinformatics InstituteConnecting life sciences data at the European Bioinformatics Institute
Connecting life sciences data at the European Bioinformatics Institute
 
Introduction to Proteogenomics
Introduction to Proteogenomics Introduction to Proteogenomics
Introduction to Proteogenomics
 
Protein database
Protein databaseProtein database
Protein database
 
SLAS Screen Design and Assay Technology SIG: SLAS2013 Presentation
SLAS Screen Design and Assay Technology SIG: SLAS2013 PresentationSLAS Screen Design and Assay Technology SIG: SLAS2013 Presentation
SLAS Screen Design and Assay Technology SIG: SLAS2013 Presentation
 
wipo_ip_mnl_19_t5.pdf
wipo_ip_mnl_19_t5.pdfwipo_ip_mnl_19_t5.pdf
wipo_ip_mnl_19_t5.pdf
 

Mais de ChemAxon

Akos Tarcsay (ChemAxon): How fast is Chemaxon RDBMS Search?
Akos Tarcsay (ChemAxon): How fast is Chemaxon RDBMS Search?Akos Tarcsay (ChemAxon): How fast is Chemaxon RDBMS Search?
Akos Tarcsay (ChemAxon): How fast is Chemaxon RDBMS Search?ChemAxon
 
Chemaxon EU UGM 2022 | Translating data to predictive models
Chemaxon EU UGM 2022 | Translating data to predictive modelsChemaxon EU UGM 2022 | Translating data to predictive models
Chemaxon EU UGM 2022 | Translating data to predictive modelsChemAxon
 
Translating data to predictive models
Translating data to predictive modelsTranslating data to predictive models
Translating data to predictive modelsChemAxon
 
Efficient biomolecular structural data handling and analysis - Webinar with D...
Efficient biomolecular structural data handling and analysis - Webinar with D...Efficient biomolecular structural data handling and analysis - Webinar with D...
Efficient biomolecular structural data handling and analysis - Webinar with D...ChemAxon
 
Biomolecule structural data management
Biomolecule structural data managementBiomolecule structural data management
Biomolecule structural data managementChemAxon
 
Cheminfo Stories 2021 | Virtual UGM | Marvin Pro: The first release
Cheminfo Stories 2021 | Virtual UGM | Marvin Pro: The first releaseCheminfo Stories 2021 | Virtual UGM | Marvin Pro: The first release
Cheminfo Stories 2021 | Virtual UGM | Marvin Pro: The first releaseChemAxon
 
Enhanced stereochemistry representation
Enhanced stereochemistry representation Enhanced stereochemistry representation
Enhanced stereochemistry representation ChemAxon
 
Intellectual property (IP) intelligence solutions designed for the way resear...
Intellectual property (IP) intelligence solutions designed for the way resear...Intellectual property (IP) intelligence solutions designed for the way resear...
Intellectual property (IP) intelligence solutions designed for the way resear...ChemAxon
 
GPS for Chemical Space - Digital Assistants to Support Molecule Design - Chem...
GPS for Chemical Space - Digital Assistants to Support Molecule Design - Chem...GPS for Chemical Space - Digital Assistants to Support Molecule Design - Chem...
GPS for Chemical Space - Digital Assistants to Support Molecule Design - Chem...ChemAxon
 
Patent Data for Artificial Intelligence based Drug Discovery
Patent Data for Artificial Intelligence based Drug DiscoveryPatent Data for Artificial Intelligence based Drug Discovery
Patent Data for Artificial Intelligence based Drug DiscoveryChemAxon
 
Cheminfo Stories APAC 2020 - Chemical Descriptors & Standardizers for Machine...
Cheminfo Stories APAC 2020 - Chemical Descriptors & Standardizers for Machine...Cheminfo Stories APAC 2020 - Chemical Descriptors & Standardizers for Machine...
Cheminfo Stories APAC 2020 - Chemical Descriptors & Standardizers for Machine...ChemAxon
 
Research data management on the cloud
Research data management on the cloudResearch data management on the cloud
Research data management on the cloudChemAxon
 
Cheminfo Stories APAC 2020 - Introducing Design Hub & Compound Registration
Cheminfo Stories APAC 2020 - Introducing Design Hub & Compound RegistrationCheminfo Stories APAC 2020 - Introducing Design Hub & Compound Registration
Cheminfo Stories APAC 2020 - Introducing Design Hub & Compound RegistrationChemAxon
 
Cheminfo Stories APAC 2020 - JChem Engines introduction
Cheminfo Stories APAC 2020 - JChem Engines introduction Cheminfo Stories APAC 2020 - JChem Engines introduction
Cheminfo Stories APAC 2020 - JChem Engines introduction ChemAxon
 
Cheminfo Stories APAC 2020 - Database management on desktop with JChem for Of...
Cheminfo Stories APAC 2020 - Database management on desktop with JChem for Of...Cheminfo Stories APAC 2020 - Database management on desktop with JChem for Of...
Cheminfo Stories APAC 2020 - Database management on desktop with JChem for Of...ChemAxon
 
Cheminfo Stories APAC 2020 -- Markush technology
Cheminfo Stories APAC 2020 -- Markush technology Cheminfo Stories APAC 2020 -- Markush technology
Cheminfo Stories APAC 2020 -- Markush technology ChemAxon
 
JChem Microservices
JChem MicroservicesJChem Microservices
JChem MicroservicesChemAxon
 
Migration from joc to jpc or choral
Migration from joc to jpc or choralMigration from joc to jpc or choral
Migration from joc to jpc or choralChemAxon
 
ChemAxon's Compliance Checker - Cheminfo Stories 2020 Day 5
ChemAxon's Compliance Checker - Cheminfo Stories 2020 Day 5ChemAxon's Compliance Checker - Cheminfo Stories 2020 Day 5
ChemAxon's Compliance Checker - Cheminfo Stories 2020 Day 5ChemAxon
 
Chemicalize Pro - Cheminfo Stories 2020 Day 5
Chemicalize Pro - Cheminfo Stories 2020 Day 5Chemicalize Pro - Cheminfo Stories 2020 Day 5
Chemicalize Pro - Cheminfo Stories 2020 Day 5ChemAxon
 

Mais de ChemAxon (20)

Akos Tarcsay (ChemAxon): How fast is Chemaxon RDBMS Search?
Akos Tarcsay (ChemAxon): How fast is Chemaxon RDBMS Search?Akos Tarcsay (ChemAxon): How fast is Chemaxon RDBMS Search?
Akos Tarcsay (ChemAxon): How fast is Chemaxon RDBMS Search?
 
Chemaxon EU UGM 2022 | Translating data to predictive models
Chemaxon EU UGM 2022 | Translating data to predictive modelsChemaxon EU UGM 2022 | Translating data to predictive models
Chemaxon EU UGM 2022 | Translating data to predictive models
 
Translating data to predictive models
Translating data to predictive modelsTranslating data to predictive models
Translating data to predictive models
 
Efficient biomolecular structural data handling and analysis - Webinar with D...
Efficient biomolecular structural data handling and analysis - Webinar with D...Efficient biomolecular structural data handling and analysis - Webinar with D...
Efficient biomolecular structural data handling and analysis - Webinar with D...
 
Biomolecule structural data management
Biomolecule structural data managementBiomolecule structural data management
Biomolecule structural data management
 
Cheminfo Stories 2021 | Virtual UGM | Marvin Pro: The first release
Cheminfo Stories 2021 | Virtual UGM | Marvin Pro: The first releaseCheminfo Stories 2021 | Virtual UGM | Marvin Pro: The first release
Cheminfo Stories 2021 | Virtual UGM | Marvin Pro: The first release
 
Enhanced stereochemistry representation
Enhanced stereochemistry representation Enhanced stereochemistry representation
Enhanced stereochemistry representation
 
Intellectual property (IP) intelligence solutions designed for the way resear...
Intellectual property (IP) intelligence solutions designed for the way resear...Intellectual property (IP) intelligence solutions designed for the way resear...
Intellectual property (IP) intelligence solutions designed for the way resear...
 
GPS for Chemical Space - Digital Assistants to Support Molecule Design - Chem...
GPS for Chemical Space - Digital Assistants to Support Molecule Design - Chem...GPS for Chemical Space - Digital Assistants to Support Molecule Design - Chem...
GPS for Chemical Space - Digital Assistants to Support Molecule Design - Chem...
 
Patent Data for Artificial Intelligence based Drug Discovery
Patent Data for Artificial Intelligence based Drug DiscoveryPatent Data for Artificial Intelligence based Drug Discovery
Patent Data for Artificial Intelligence based Drug Discovery
 
Cheminfo Stories APAC 2020 - Chemical Descriptors & Standardizers for Machine...
Cheminfo Stories APAC 2020 - Chemical Descriptors & Standardizers for Machine...Cheminfo Stories APAC 2020 - Chemical Descriptors & Standardizers for Machine...
Cheminfo Stories APAC 2020 - Chemical Descriptors & Standardizers for Machine...
 
Research data management on the cloud
Research data management on the cloudResearch data management on the cloud
Research data management on the cloud
 
Cheminfo Stories APAC 2020 - Introducing Design Hub & Compound Registration
Cheminfo Stories APAC 2020 - Introducing Design Hub & Compound RegistrationCheminfo Stories APAC 2020 - Introducing Design Hub & Compound Registration
Cheminfo Stories APAC 2020 - Introducing Design Hub & Compound Registration
 
Cheminfo Stories APAC 2020 - JChem Engines introduction
Cheminfo Stories APAC 2020 - JChem Engines introduction Cheminfo Stories APAC 2020 - JChem Engines introduction
Cheminfo Stories APAC 2020 - JChem Engines introduction
 
Cheminfo Stories APAC 2020 - Database management on desktop with JChem for Of...
Cheminfo Stories APAC 2020 - Database management on desktop with JChem for Of...Cheminfo Stories APAC 2020 - Database management on desktop with JChem for Of...
Cheminfo Stories APAC 2020 - Database management on desktop with JChem for Of...
 
Cheminfo Stories APAC 2020 -- Markush technology
Cheminfo Stories APAC 2020 -- Markush technology Cheminfo Stories APAC 2020 -- Markush technology
Cheminfo Stories APAC 2020 -- Markush technology
 
JChem Microservices
JChem MicroservicesJChem Microservices
JChem Microservices
 
Migration from joc to jpc or choral
Migration from joc to jpc or choralMigration from joc to jpc or choral
Migration from joc to jpc or choral
 
ChemAxon's Compliance Checker - Cheminfo Stories 2020 Day 5
ChemAxon's Compliance Checker - Cheminfo Stories 2020 Day 5ChemAxon's Compliance Checker - Cheminfo Stories 2020 Day 5
ChemAxon's Compliance Checker - Cheminfo Stories 2020 Day 5
 
Chemicalize Pro - Cheminfo Stories 2020 Day 5
Chemicalize Pro - Cheminfo Stories 2020 Day 5Chemicalize Pro - Cheminfo Stories 2020 Day 5
Chemicalize Pro - Cheminfo Stories 2020 Day 5
 

Último

Exploring the Best Video Editing App.pdf
Exploring the Best Video Editing App.pdfExploring the Best Video Editing App.pdf
Exploring the Best Video Editing App.pdfproinshot.com
 
Shapes for Sharing between Graph Data Spaces - and Epistemic Querying of RDF-...
Shapes for Sharing between Graph Data Spaces - and Epistemic Querying of RDF-...Shapes for Sharing between Graph Data Spaces - and Epistemic Querying of RDF-...
Shapes for Sharing between Graph Data Spaces - and Epistemic Querying of RDF-...Steffen Staab
 
%in ivory park+277-882-255-28 abortion pills for sale in ivory park
%in ivory park+277-882-255-28 abortion pills for sale in ivory park %in ivory park+277-882-255-28 abortion pills for sale in ivory park
%in ivory park+277-882-255-28 abortion pills for sale in ivory park masabamasaba
 
10 Trends Likely to Shape Enterprise Technology in 2024
10 Trends Likely to Shape Enterprise Technology in 202410 Trends Likely to Shape Enterprise Technology in 2024
10 Trends Likely to Shape Enterprise Technology in 2024Mind IT Systems
 
Learn the Fundamentals of XCUITest Framework_ A Beginner's Guide.pdf
Learn the Fundamentals of XCUITest Framework_ A Beginner's Guide.pdfLearn the Fundamentals of XCUITest Framework_ A Beginner's Guide.pdf
Learn the Fundamentals of XCUITest Framework_ A Beginner's Guide.pdfkalichargn70th171
 
%in Stilfontein+277-882-255-28 abortion pills for sale in Stilfontein
%in Stilfontein+277-882-255-28 abortion pills for sale in Stilfontein%in Stilfontein+277-882-255-28 abortion pills for sale in Stilfontein
%in Stilfontein+277-882-255-28 abortion pills for sale in Stilfonteinmasabamasaba
 
How To Troubleshoot Collaboration Apps for the Modern Connected Worker
How To Troubleshoot Collaboration Apps for the Modern Connected WorkerHow To Troubleshoot Collaboration Apps for the Modern Connected Worker
How To Troubleshoot Collaboration Apps for the Modern Connected WorkerThousandEyes
 
A Secure and Reliable Document Management System is Essential.docx
A Secure and Reliable Document Management System is Essential.docxA Secure and Reliable Document Management System is Essential.docx
A Secure and Reliable Document Management System is Essential.docxComplianceQuest1
 
Chinsurah Escorts ☎️8617697112 Starting From 5K to 15K High Profile Escorts ...
Chinsurah Escorts ☎️8617697112  Starting From 5K to 15K High Profile Escorts ...Chinsurah Escorts ☎️8617697112  Starting From 5K to 15K High Profile Escorts ...
Chinsurah Escorts ☎️8617697112 Starting From 5K to 15K High Profile Escorts ...Nitya salvi
 
LEVEL 5 - SESSION 1 2023 (1).pptx - PDF 123456
LEVEL 5   - SESSION 1 2023 (1).pptx - PDF 123456LEVEL 5   - SESSION 1 2023 (1).pptx - PDF 123456
LEVEL 5 - SESSION 1 2023 (1).pptx - PDF 123456KiaraTiradoMicha
 
Sector 18, Noida Call girls :8448380779 Model Escorts | 100% verified
Sector 18, Noida Call girls :8448380779 Model Escorts | 100% verifiedSector 18, Noida Call girls :8448380779 Model Escorts | 100% verified
Sector 18, Noida Call girls :8448380779 Model Escorts | 100% verifiedDelhi Call girls
 
TECUNIQUE: Success Stories: IT Service provider
TECUNIQUE: Success Stories: IT Service providerTECUNIQUE: Success Stories: IT Service provider
TECUNIQUE: Success Stories: IT Service providermohitmore19
 
Define the academic and professional writing..pdf
Define the academic and professional writing..pdfDefine the academic and professional writing..pdf
Define the academic and professional writing..pdfPearlKirahMaeRagusta1
 
HR Software Buyers Guide in 2024 - HRSoftware.com
HR Software Buyers Guide in 2024 - HRSoftware.comHR Software Buyers Guide in 2024 - HRSoftware.com
HR Software Buyers Guide in 2024 - HRSoftware.comFatema Valibhai
 
The title is not connected to what is inside
The title is not connected to what is insideThe title is not connected to what is inside
The title is not connected to what is insideshinachiaurasa2
 
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...panagenda
 
VTU technical seminar 8Th Sem on Scikit-learn
VTU technical seminar 8Th Sem on Scikit-learnVTU technical seminar 8Th Sem on Scikit-learn
VTU technical seminar 8Th Sem on Scikit-learnAmarnathKambale
 
Crypto Cloud Review - How To Earn Up To $500 Per DAY Of Bitcoin 100% On AutoP...
Crypto Cloud Review - How To Earn Up To $500 Per DAY Of Bitcoin 100% On AutoP...Crypto Cloud Review - How To Earn Up To $500 Per DAY Of Bitcoin 100% On AutoP...
Crypto Cloud Review - How To Earn Up To $500 Per DAY Of Bitcoin 100% On AutoP...SelfMade bd
 
Right Money Management App For Your Financial Goals
Right Money Management App For Your Financial GoalsRight Money Management App For Your Financial Goals
Right Money Management App For Your Financial GoalsJhone kinadey
 
The Ultimate Test Automation Guide_ Best Practices and Tips.pdf
The Ultimate Test Automation Guide_ Best Practices and Tips.pdfThe Ultimate Test Automation Guide_ Best Practices and Tips.pdf
The Ultimate Test Automation Guide_ Best Practices and Tips.pdfkalichargn70th171
 

Último (20)

Exploring the Best Video Editing App.pdf
Exploring the Best Video Editing App.pdfExploring the Best Video Editing App.pdf
Exploring the Best Video Editing App.pdf
 
Shapes for Sharing between Graph Data Spaces - and Epistemic Querying of RDF-...
Shapes for Sharing between Graph Data Spaces - and Epistemic Querying of RDF-...Shapes for Sharing between Graph Data Spaces - and Epistemic Querying of RDF-...
Shapes for Sharing between Graph Data Spaces - and Epistemic Querying of RDF-...
 
%in ivory park+277-882-255-28 abortion pills for sale in ivory park
%in ivory park+277-882-255-28 abortion pills for sale in ivory park %in ivory park+277-882-255-28 abortion pills for sale in ivory park
%in ivory park+277-882-255-28 abortion pills for sale in ivory park
 
10 Trends Likely to Shape Enterprise Technology in 2024
10 Trends Likely to Shape Enterprise Technology in 202410 Trends Likely to Shape Enterprise Technology in 2024
10 Trends Likely to Shape Enterprise Technology in 2024
 
Learn the Fundamentals of XCUITest Framework_ A Beginner's Guide.pdf
Learn the Fundamentals of XCUITest Framework_ A Beginner's Guide.pdfLearn the Fundamentals of XCUITest Framework_ A Beginner's Guide.pdf
Learn the Fundamentals of XCUITest Framework_ A Beginner's Guide.pdf
 
%in Stilfontein+277-882-255-28 abortion pills for sale in Stilfontein
%in Stilfontein+277-882-255-28 abortion pills for sale in Stilfontein%in Stilfontein+277-882-255-28 abortion pills for sale in Stilfontein
%in Stilfontein+277-882-255-28 abortion pills for sale in Stilfontein
 
How To Troubleshoot Collaboration Apps for the Modern Connected Worker
How To Troubleshoot Collaboration Apps for the Modern Connected WorkerHow To Troubleshoot Collaboration Apps for the Modern Connected Worker
How To Troubleshoot Collaboration Apps for the Modern Connected Worker
 
A Secure and Reliable Document Management System is Essential.docx
A Secure and Reliable Document Management System is Essential.docxA Secure and Reliable Document Management System is Essential.docx
A Secure and Reliable Document Management System is Essential.docx
 
Chinsurah Escorts ☎️8617697112 Starting From 5K to 15K High Profile Escorts ...
Chinsurah Escorts ☎️8617697112  Starting From 5K to 15K High Profile Escorts ...Chinsurah Escorts ☎️8617697112  Starting From 5K to 15K High Profile Escorts ...
Chinsurah Escorts ☎️8617697112 Starting From 5K to 15K High Profile Escorts ...
 
LEVEL 5 - SESSION 1 2023 (1).pptx - PDF 123456
LEVEL 5   - SESSION 1 2023 (1).pptx - PDF 123456LEVEL 5   - SESSION 1 2023 (1).pptx - PDF 123456
LEVEL 5 - SESSION 1 2023 (1).pptx - PDF 123456
 
Sector 18, Noida Call girls :8448380779 Model Escorts | 100% verified
Sector 18, Noida Call girls :8448380779 Model Escorts | 100% verifiedSector 18, Noida Call girls :8448380779 Model Escorts | 100% verified
Sector 18, Noida Call girls :8448380779 Model Escorts | 100% verified
 
TECUNIQUE: Success Stories: IT Service provider
TECUNIQUE: Success Stories: IT Service providerTECUNIQUE: Success Stories: IT Service provider
TECUNIQUE: Success Stories: IT Service provider
 
Define the academic and professional writing..pdf
Define the academic and professional writing..pdfDefine the academic and professional writing..pdf
Define the academic and professional writing..pdf
 
HR Software Buyers Guide in 2024 - HRSoftware.com
HR Software Buyers Guide in 2024 - HRSoftware.comHR Software Buyers Guide in 2024 - HRSoftware.com
HR Software Buyers Guide in 2024 - HRSoftware.com
 
The title is not connected to what is inside
The title is not connected to what is insideThe title is not connected to what is inside
The title is not connected to what is inside
 
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...
 
VTU technical seminar 8Th Sem on Scikit-learn
VTU technical seminar 8Th Sem on Scikit-learnVTU technical seminar 8Th Sem on Scikit-learn
VTU technical seminar 8Th Sem on Scikit-learn
 
Crypto Cloud Review - How To Earn Up To $500 Per DAY Of Bitcoin 100% On AutoP...
Crypto Cloud Review - How To Earn Up To $500 Per DAY Of Bitcoin 100% On AutoP...Crypto Cloud Review - How To Earn Up To $500 Per DAY Of Bitcoin 100% On AutoP...
Crypto Cloud Review - How To Earn Up To $500 Per DAY Of Bitcoin 100% On AutoP...
 
Right Money Management App For Your Financial Goals
Right Money Management App For Your Financial GoalsRight Money Management App For Your Financial Goals
Right Money Management App For Your Financial Goals
 
The Ultimate Test Automation Guide_ Best Practices and Tips.pdf
The Ultimate Test Automation Guide_ Best Practices and Tips.pdfThe Ultimate Test Automation Guide_ Best Practices and Tips.pdf
The Ultimate Test Automation Guide_ Best Practices and Tips.pdf
 

EUGM15 - George Papadatos, Mark Davies, Nathan Dedman (EMBL-EBI): SureChEMBL: An Open Patent Chemistry Resource