SlideShare uma empresa Scribd logo
Introdução à Modelagem de
        Proteínas por Homologia

                                               MSc. Ronaldo Correia
                        Genética e Biologia Molecular - Bioinformática
Laboratório de Planejamento e Desenvolvimento de Fármacos – LPDF -
                                                                UFPa


                               Belém-PA
                            Novembro de 2012
Objetivos

 Oferecer noções básicas sobre Proteínas;


 Apresentar técnicas de modelagem de Proteínas;


 Discutir a importância dessas técnicas para o
 proteoma e planejamento de fármacos.
Introdução
                    Bioinformática




                       Proteínas



      Métodos                        Métodos
    experimentais                    Teóricos
Aula teorica minicurso modelagem de proteinas por homologia

Recomendado para você

Genetica forense
Genetica forense Genetica forense
Genetica forense

Este documento discute a genética forense, incluindo seu uso na identificação criminal por meio de DNA desde 1985. Detalha amostras biológicas de interesse forense, como sangue e saliva, e os passos para obter perfis de DNA, incluindo isolamento, corte e separação de fragmentos. Também menciona bancos de dados criminais como CODIS usado pelo FBI para comparar perfis genéticos.

#biologiamolecular #ppt #geneticaforense
Aula 12 - Tecnologia do DNA recombinante
Aula 12 - Tecnologia do DNA recombinanteAula 12 - Tecnologia do DNA recombinante
Aula 12 - Tecnologia do DNA recombinante

Um gene é um segmento de DNA que codifica uma proteína através do código genético universal. O processo de síntese de proteínas envolve a transcrição do DNA em RNA mensageiro e a tradução do RNAm em uma cadeia de aminoácidos. A engenharia genética permite manipular genes através de técnicas como o uso de enzimas de restrição e eletroforese para isolar, cortar e identificar fragmentos de DNA.

dnasíntese de proteínasteste de paternidade
Aula molecular 1
Aula molecular 1Aula molecular 1
Aula molecular 1

1. Os cromossomos contêm o DNA, que é constituído por nucleotídeos. O DNA armazena as instruções genéticas para a construção e funcionamento de todos os organismos vivos.

Seres protéicos

 A vida está intimamente ligada às proteínas. Estas
 moléculas especiais realizam as mais variadas funções no
 nosso organismo tais como:

   Transporte de nutrientes e metabólitos, catálise de reações
   biológicas;

   Apesar da complexidade de suas funções, as proteínas são
   relativamente simples;

   Repetições de 20 unidades básicas, os aminoácidos.
Proteínas x Meio Ambiente

 Metano: 25 x maior potencial efeito estufa que
 CO2

 As arqueias metanogênicas são responsáveis
 por 74% do       metano   liberado   em   nossa
 atmosfera.

 Metil coenzima redutase (MCR): catálise da
 metanogênese.

                                       LIMA, 2012
Proteínas x Meio Ambiente




                            LIMA, 2012
Luciferase




Hemoglobina




Queratina

Recomendado para você

Pcr
PcrPcr
Pcr

O documento descreve a reação de polimerização em cadeia (PCR), um método para amplificar seletivamente regiões específicas de DNA. A PCR usa primers, Taq polimerase e ciclos de aquecimento e resfriamento para replicar o DNA alvo exponencialmente. Isso permite detecções sensíveis de sequências genéticas em aplicações como diagnóstico médico e pesquisa.

reação de polimerização em cadeia
II. 2 Carboidratos, lipídios e proteínas
II. 2 Carboidratos, lipídios e proteínasII. 2 Carboidratos, lipídios e proteínas
II. 2 Carboidratos, lipídios e proteínas

Baseado em: PEREIRA, A. M; WALDHELM, M. Novo passaporte para Ciências. 9o ano. 2a ed. São Paulo: Editora do Brasil, 2009.

Eletroforese
EletroforeseEletroforese
Eletroforese

A eletroforese é uma técnica bioquímica versátil para separar moléculas como proteínas, ácidos nucléicos e enzimas com base em seu tamanho e carga elétrica através de um campo elétrico. Ela é amplamente utilizada em estudos de genética, taxonomia, bioquímica e outras áreas da biologia. A técnica envolve a migração das moléculas através de um gel sob a influência de um campo elétrico.

Aminoácido
 Um aminoácido consiste em um caborno “central” com
 uma ligação a grupo amino (-NH2), outra a um grupo
 carboxila (-COOH), a terceira a um átomo de
 hidrogênio e a quarta a uma cadeia lateral variável




            Carbono α
Asparagina   Ácido Aspartico




Tirosina       Fenilalanina
Aminoácidos
 Single- & three-letter amino acid codes
   G Glycine       Gly         P   Proline      Pro
   A  Alanine      Ala         V   Valine       Val
   L   Leucine     Leu         I   Isoleucine Ile
   M Methionine    Met         C   Cysteine     Cys
   F Phenylalanine Phe         Y   Tyrosine     Tyr
   W Tryptophan    Trp         H   Histidine    His
   K Lysine        Lys         R   Arginine     Arg
   Q Glutamine     Gln         N   Asparagine Asn
   E Glutamic Acid Glu         D   Aspartic Acid Asp
   S Serine        Ser         T   Threonine Thr
Classificação dos aminoácidos
 Os aminoácidos podem ser classificados de
 acordo com o grupo R como:

  Alifáticos (não polares) – sem polos,sem carga;


  Não carregados, polares – mas com eminência;


  Carregados positivamente;


  Carregados Negativamente.

Recomendado para você

Química orgânica - Isomeria
Química orgânica - IsomeriaQuímica orgânica - Isomeria
Química orgânica - Isomeria

O documento discute os diferentes tipos de isomeria em química orgânica, incluindo isomeria constitucional, de posição, de função, de compensação, tautomeria e isomeria espacial. Explica cada tipo de isomeria com exemplos de compostos orgânicos.

quimica orgânica
Estrategias purificacao analises proteínas
Estrategias purificacao analises proteínasEstrategias purificacao analises proteínas
Estrategias purificacao analises proteínas

O documento discute estratégias de purificação e análises de proteínas. Inicialmente, apresenta métodos de purificação baseados em características físico-químicas como tamanho, carga e solubilidade. Também discute métodos baseados em afinidade biológica. Explica que análises complementares como medição de atividade biológica e conteúdo proteico devem ser feitas durante a purificação.

QUIMICA GERAL Aula 01
QUIMICA GERAL Aula 01QUIMICA GERAL Aula 01
QUIMICA GERAL Aula 01

Este documento apresenta informações sobre um curso de Química Geral e Inorgânica ministrado pela professora Daiane Fossatti Dall'Oglio entre setembro de 2013 e janeiro de 2014. O curso terá carga horária de 75 horas e abordará tópicos como a origem da química, classificação da matéria, moléculas e compostos moleculares, e propriedades físicas e químicas. Os alunos serão avaliados por meio de provas escritas e produção de materiais ped

quimicageralexercicios
Sem O2
para fazer
ligações.
O2 presente
(possui pólos)
para fazer ligações
com carbono e
hidrogênio.
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia

Recomendado para você

Estequiometria - Prof. Fernando Abreu
Estequiometria - Prof. Fernando AbreuEstequiometria - Prof. Fernando Abreu
Estequiometria - Prof. Fernando Abreu

Este documento discute os princípios da estequiometria, incluindo: 1) Leis da conservação de massa e proporções constantes; 2) Equações químicas e balanceamento; 3) Cálculos estequiométricos usando massa, volume ou mols de reagentes e produtos. Exemplos demonstram como resolver problemas envolvendo reações químicas quantitativas.

Aula 9 - Metabolismo energético - Respiração celular e Fermentação
Aula 9 - Metabolismo energético - Respiração celular e FermentaçãoAula 9 - Metabolismo energético - Respiração celular e Fermentação
Aula 9 - Metabolismo energético - Respiração celular e Fermentação

O documento discute os processos de respiração celular aeróbica e anaeróbica. A respiração aeróbica inclui a glicólise, ciclo de Krebs e cadeia transportadora de elétrons para produzir um rendimento líquido de 36 moléculas de ATP por molécula de glicose. A respiração anaeróbica inclui fermentações como a alcoólica e lática que produzem ATP sem oxigênio como aceptor final de elétrons.

respiração celularrespiração celular aeróbicafermentação
III. 1 Histórico Biotecnologia
III. 1 Histórico BiotecnologiaIII. 1 Histórico Biotecnologia
III. 1 Histórico Biotecnologia

Baseado em: PEREIRA, A. M; WALDHELM, M. Novo passaporte para Ciências. 9o ano. 2a ed. São Paulo: Editora do Brasil, 2009.

Ligação Peptídica
 Os peptídeos são biomoléculas formadas pela
 ligação de dois ou mais aminoácidos através de
 ligações do tipo amida. Os peptídeos são
 resultantes do processamento de proteínas e
 podem variar de 2 ou mais aminoácidos.

        2 aminoácidos: Dipeptídeo
        3 aminoácidos: Tripeptídeo
        4 a 10 aminoácidos: Oligopeptídeo
        10 a 100 aminoácidos: Polipeptídeo
        mais de 100 aminoácidos: Proteína
Vasopressina (ADH)
oxitocina ou ocitocina.       9 aminoácidos
9 aminoácidos




                Insulina                Glucagon
            51 amino ácidos         29 amino ácidos
Conformação do Esqueleto
Aula teorica minicurso modelagem de proteinas por homologia

Recomendado para você

ENZIMAS.ppt
ENZIMAS.pptENZIMAS.ppt
ENZIMAS.ppt

1) O documento discute as enzimas, proteínas que catalisam reações químicas nas células e reduzem a energia necessária para iniciar essas reações. 2) As enzimas atuam como catalisadores eficientes que aceleram as reações químicas sem serem consumidas no processo. 3) As enzimas possuem alta especificidade e só catalisam reações específicas, geralmente agindo em apenas um substrato.

Aula sobre-mutacoes
Aula sobre-mutacoesAula sobre-mutacoes
Aula sobre-mutacoes

O documento discute mutações no DNA, definindo-as como alterações ou modificações súbitas em genes ou cromossomos que podem acarretar variação hereditária. Descreve tipos de mutações como cromossômicas, gênicas e genômicas e seus efeitos, e discute doenças causadas por mutações como fenilcetonúria, alcaptonúria e doenças de armazenamento lisossômico.

Estequiometria
EstequiometriaEstequiometria
Estequiometria

Este documento discute os conceitos fundamentais de estequiometria, incluindo: 1) O conceito de mol e número de Avogadro e como eles se relacionam com massas atômicas; 2) Como converter entre números de átomos, moles e massas; 3) A função e importância das equações químicas balanceadas para cálculos químicos.

estequiometria
Interações não covalentes
  Ligação de Hidrogênio




Ponte de H
formada entre duas
moléculas de água
Eletronegatividade
Low Barrier Hydrogen Bond
(LBHB)
 Ligação de Hidrogênio
Interações de van der Waals

Recomendado para você

Substituição Eletrofílica Aromática
Substituição Eletrofílica AromáticaSubstituição Eletrofílica Aromática
Substituição Eletrofílica Aromática

O documento discute reações de substituição eletrofílica aromática em derivados de benzeno. Descreve a estrutura e propriedades do benzeno e explica como vários eletrófilos podem ser adicionados ao anel aromático através deste tipo de reação, incluindo halogenação, sulfonação, nitração, alquilação de Friedel-Crafts e acilação de Friedel-Crafts. O mecanismo geral envolve o ataque nucleofílico do anel aromático ao eletrófilo, formação

aromaticosreações
Quimica tabela periodica
Quimica tabela periodicaQuimica tabela periodica
Quimica tabela periodica

O documento descreve a evolução da Tabela Periódica dos Elementos desde sua criação por Dmitri Mendeleev até a versão atual. Mendeleev organizou os 63 elementos conhecidos em ordem de massa atômica, agrupando elementos com propriedades semelhantes. Posteriormente, Henry Moseley estabeleceu que o número atômico é a base para organizá-los, e Glenn Seaborg reconfigurou a tabela para incluir os elementos transurânicos.

prof. andrei nóbrega
Controle hormonal do ciclo menstrual
Controle hormonal do ciclo menstrualControle hormonal do ciclo menstrual
Controle hormonal do ciclo menstrual

The document discusses hormonal control of the menstrual cycle. The menstrual cycle is regulated by hormones produced by the hypothalamus and pituitary glands in the brain and by the ovaries. These hormones control the growth and shedding of the uterine lining each menstrual cycle over approximately 28 days in a precise sequence of hormonal changes and responses by the ovaries and endometrium.

hormonios ovarianostpmmenstruaçao
Interação Hidrofóbica




          Gotas de óleo na água
Ponte de Dissulfeto


                      Grupo
                      sulfidril
Aula teorica minicurso modelagem de proteinas por homologia
Resíduo        %
  Cysteine      17.5
    Serine      11.7
Glutamic acid   11.1
 Threonine      6.9
   Glycine      6.5
   Leucine      6.1
    Valine      5.9
  Arginine      5.6
Aspartic acid   5.0
   Alanine      4.8
   Proline      3.6
 Isoleucine     2.7
  Tyrosine      1.9
Phenylalanine   1.4
  Histidine     0.8

Recomendado para você

Genética – 2 lei de mendel
Genética – 2 lei de mendelGenética – 2 lei de mendel
Genética – 2 lei de mendel

Gregor Mendel estudou características de ervilhas e descobriu leis da hereditariedade. Ele observou que genes segregam independentemente durante a formação de gametas e que a combinação aleatória de genes em zigotos leva a proporções previsíveis de tipos de descendentes.

Bioestatistica basica completa-apresentacao
Bioestatistica basica completa-apresentacaoBioestatistica basica completa-apresentacao
Bioestatistica basica completa-apresentacao

O documento apresenta um programa de bioestatística básica que aborda os seguintes tópicos: importância da bioestatística, variáveis, população e amostras, apresentação de dados em tabelas, medidas de tendência central, distribuição normal, correlação e regressão, risco relativo/odds ratio, testes de hipóteses, análise de evidências em medicina, escolha de testes estatísticos e testes não paramétricos.

SISTEMA DIGESTORIO
SISTEMA DIGESTORIOSISTEMA DIGESTORIO
SISTEMA DIGESTORIO

1) O documento descreve os principais órgãos do sistema digestório humano, incluindo a boca, faringe, esôfago, estômago, intestino delgado, intestino grosso e suas funções na digestão de alimentos. 2) Nos órgãos iniciais, como a boca e o estômago, ocorre a quebra mecânica e química de alimentos por enzimas. 3) No intestino delgado ocorre a maior parte da digestão e absorção de nutrientes, auxiliada por enzimas pancreáticas

 Covalent Bond ~ 50 - 100kcal/mol
 Ionic Bond ~ 5 - 80kcal/mol
 Hydrogen Bond ~ 3 - 6kcal/mol
 Hydrophobic Interaction ~ 0.5 -
  3kcal/mol (not a bond per se)
 Van der Waals Interaction ~ 1kcal/mol
Proteínas
 Definição: são macromoléculas complexas,
 compostas de aminoácidos, e necessárias
 para os processos químicos que ocorrem nos
 organismos vivos

 Nos animais, as proteínas correspondem a
 cerca de 80% do peso dos músculos
 desidratados, cerca de 70% da pele e 90% do
 sangue seco.
Estrutura Primária




    amino terminal ou "N-terminal" (NH3+)
    carboxi terminal ("C-terminal") (COO-)
FASTA
 >2ANL:A|PDBID|CHAIN|SEQUENCE
 SENDVIELDDVANLMFYGEGEVGDNHQKFMLIFDTGSANLWVPS
 KCNSIGCSTKHLYDSSKSKSYEKDGTKVEITYGSGVRGFFSKDLVT
 LGYLSLPYKFIEVTDTDDLEPLYTAAEFDGILGLGWKDLSIGSIDPI
 VVELKNQNKIDQALFTFYLPVHDKHSGYLTIGGIEEKFYEGELTYE
 KLNHDLFWQVDLDVNFGKTSMEKANVIVDSGTSTITAPTSFINKFF
 KDLNVIKVPFLPFYITTCNNKDMPTLEFKSANNTYTLEPEYYMEPL
 LDIDDTLCMLYILPVDIDKNTFILGDPFMRKYFTVFDYDKESIGFAV
 AKN

Recomendado para você

áCidos nucléicos slides
áCidos nucléicos slidesáCidos nucléicos slides
áCidos nucléicos slides

O documento discute ácidos nucléicos, incluindo DNA e RNA. Ele explica a estrutura do DNA, como é formado por nucleotídeos ligados por fosfodiésteres. Também cobre a descoberta da estrutura em dupla hélice do DNA por Watson e Crick e o processo de replicação semi-conservativa do DNA.

Bioquimica
BioquimicaBioquimica
Bioquimica

O documento descreve os principais componentes químicos encontrados nos seres vivos, incluindo água, sais minerais, carboidratos, lipídios, proteínas e vitaminas. Ele também discute as funções dessas moléculas, como o armazenamento e transporte de energia por carboidratos e a catalise de reações bioquímicas por enzimas proteicas. Além disso, fornece detalhes sobre os aminoácidos que compõem as proteínas e as diferentes classes de vitaminas presentes nos organismos.

Aula 06 Sistema nervoso e sensorial - anatomia
Aula 06   Sistema nervoso e sensorial - anatomiaAula 06   Sistema nervoso e sensorial - anatomia
Aula 06 Sistema nervoso e sensorial - anatomia

O documento descreve aspectos gerais do sistema nervoso e sensoriais, incluindo sua estrutura celular, tipos de neurônios, critérios funcionais e morfológicos. O sistema nervoso central é dividido em cérebro, tronco cerebral, cerebelo e medula espinhal. O documento também descreve os nervos cranianos e espinhais, plexos nervosos e o sistema nervoso autônomo simpático e parassimpático.

nervous system anatomy
Estrutura Secundária

 A estrutura secundária é uma função dos
 ângulos formados pelas ligações peptídicas
 que ligam os aminoácidos

 A conformação espacial é mantida graças as
 interações      intermoleculares    (ligação
 hidrogênio) entre os hidrogênios dos grupos
 amino e os átomos de oxigênio dos outros
 amino ácidos.
-Hélice
           É a forma mais comum de estrutura
            secundária regular;

           Caracteriza-se por uma hélice em
            espiral formada por volta de 3 a 6
            aminoácidos;

           As cadeias laterais dos aminoácidos
            se distribuem para fora da hélice

           A principal força de estabilização da a -
            Hélice é a ponte de hidrogênio.
-Folhas
           Envolve    2 ou mais segmentos
            polipeptídicos da mesma molécula ou
            de moléculas diferentes, arranjados
            em paralelo ou no sentido anti-
            paralelo

           Os segmentos em folha   da proteína
            adquirem um aspecto de uma folha
            de papel dobrada em pregas.

           As pontes de hidrogênio mais uma
            vez são a força de estabilização
            principal desta estrutura
Aula teorica minicurso modelagem de proteinas por homologia

Recomendado para você

Genética probabilidade slides
Genética probabilidade slidesGenética probabilidade slides
Genética probabilidade slides

O documento apresenta conceitos básicos de probabilidade aplicados em genética, como cálculo de probabilidade simples, regra do produto e regra da soma. Exemplos incluem a probabilidade de escolher uma mulher loira, ter filhos do mesmo sexo ou diferentes sexos, e fórmulas para calcular essas probabilidades.

probabilidade em genetica
Genética probabilidade slides
Genética probabilidade slidesGenética probabilidade slides
Genética probabilidade slides

O documento discute conceitos de probabilidade aplicados em genética, incluindo cálculo de probabilidade simples, regra do produto e regra da soma. A regra do produto estabelece que a probabilidade de dois ou mais eventos ocorrerem conjuntamente é igual ao produto das probabilidades deles ocorrerem separadamente. Já a regra da soma estabelece que a probabilidade de dois eventos que se excluem mutuamente é igual à soma das probabilidades de cada um ocorrer isoladamente. Exemplos de aplicação dessas regras em genética são apresentados.

Taxonomia
TaxonomiaTaxonomia
Taxonomia

O documento discute a taxonomia, a classificação biológica dos seres vivos estabelecida por Lineu em 1758, que incluiu cinco categorias taxonômicas (reino, filo/divisão, classe, ordem, família, gênero e espécie) e as regras de nomenclatura binomial. A filogenia estuda as relações de ancestralidade e descendência entre os organismos.

Aula teorica minicurso modelagem de proteinas por homologia
Qual seria Beta Folha?
Estrutura Terciária
 A estrutura terciária relaciona-se com os
 loopings e dobraduras da cadeia protéica
 sobre ela mesma.

 É a conformação espacial da proteína, como
 um todo, e não de determinados segmentos
 particulares da cadeia protéica.

 A forma das proteínas está relacionada com
 sua estrutura terciária.
Estrutura Terciária
                       -Folhas




                  Loop


             -Hélice



                                 2CBJ

Recomendado para você

Embriologia
EmbriologiaEmbriologia
Embriologia

O documento descreve as principais etapas do desenvolvimento embrionário, incluindo segmentação, gastrulação, organogênese e formação de anexos embrionários. A segmentação envolve a divisão celular do embrião em estágios como mórula e blástula. Durante a gastrulação, os folhetos germinativos se diferenciam. Na organogênese, os tecidos e órgãos se formam a partir desses folhetos. Anexos como a vesícula vitelínica, âmnio e cordão umb

Sistema reprodutor feminino
Sistema reprodutor femininoSistema reprodutor feminino
Sistema reprodutor feminino

El documento describe los principales componentes del sistema reproductor femenino, incluyendo los ovarios, que producen óvulos y hormonas como el estrógeno y la progesterona; las trompas de Falopio, que transportan los óvulos a la cavidad uterina; el útero, donde ocurre la implantación en caso de fertilización; y la vagina, por donde pasa el feto durante el parto. También menciona brevemente la esterilización femenina por cirugía.

reproduçaosistemas humanos
Introdução à Anatomia e Fisiologia Humana
Introdução à Anatomia e Fisiologia HumanaIntrodução à Anatomia e Fisiologia Humana
Introdução à Anatomia e Fisiologia Humana

O documento apresenta uma introdução à anatomia e fisiologia humana, definindo os termos e discutindo a organização do corpo em nível celular, tecidual, de órgãos e sistemas. É explicado que a anatomia se refere à estrutura e a fisiologia ao funcionamento, com ênfase na composição e função das células e tecidos que compõem o corpo humano.

Estrutura Quaternária
Hemoglobina
Aula teorica minicurso modelagem de proteinas por homologia
Previsão de Estrutura de Proteínas



                       Raios X       Cerca de 10 a 14 mil estruturas
                                     em repositórios públicos
   Experimental
                                          102.000 mil estruturas
                         RMN              primárias



                                     Homologia

                   Teórico

                                     Ab initio

Recomendado para você

Morfologia externa das angiospermas
Morfologia externa das angiospermasMorfologia externa das angiospermas
Morfologia externa das angiospermas

A raiz fixa as plantas no solo e absorve água e nutrientes. O caule sustenta a planta e transporta seivas. As folhas realizam a fotossíntese. O fruto protege e dispersa as sementes.

florangiospermasraiz
Sistema DigestóRio
Sistema DigestóRioSistema DigestóRio
Sistema DigestóRio

O documento descreve o sistema digestório humano, incluindo sua função de digerir e absorver alimentos e excretar dejetos. Ele discute cada órgão do sistema digestório, desde a boca até o ânus, descrevendo suas partes, relações anatômicas, irrigação sanguínea e inervação.

digestóriosistemadigestório
Bioquimica
BioquimicaBioquimica
Bioquimica

O documento discute os principais componentes químicos encontrados nos seres vivos, incluindo água, sais minerais, carboidratos, lipídios, proteínas e vitaminas. Ele também explica as funções dessas moléculas, como o armazenamento e transporte de energia por carboidratos, a formação de estruturas celulares por lipídios, e a catalise de reações bioquímicas por enzimas proteicas. Finalmente, o documento lista alguns sais minerais e vitaminas essenciais e suas funções no cor

agualipidioscarboidratos
Aula teorica minicurso modelagem de proteinas por homologia
Por que modelar proteínas?

 Dificuldade em se obter estruturas experimentais;


 Custo elevado
Por que modelar proteínas?
Informações Obtidas Através da
Estrutura 3D
 Organização estrutural


   Estudos sobre o comportamento
   dos resíduos

   Propriedades     eletrostáticas   dos
   sítios ativos de enzimas

Recomendado para você

Genética – leis de mendel slides
Genética – leis de mendel slidesGenética – leis de mendel slides
Genética – leis de mendel slides

Gregor Mendel estudou a hereditariedade em ervilhas e descobriu duas leis fundamentais: 1) A lei da segregação, que afirma que os pares de fatores se separam nos gametas, que herdam um fator cada; 2) A lei da independência, que mostra que os fatores se herdam independentemente uns dos outros. Ele realizou cruzamentos e observou as proporções nas gerações F1 e F2, apoiando suas leis.

primeiralei de mendelgenética
Platelmintos
PlatelmintosPlatelmintos
Platelmintos

O documento descreve três doenças causadas por platelmintos: esquistossomose, causada pelo Schistosoma e transmitida por caramujos d'água; teníase, transmitida por ingestão de ovos de Taenia em alimentos ou água contaminados, e cistocercose, quando ovos de Taenia desenvolvem cistos em outros órgãos do corpo humano.

Sistemanervoso
SistemanervosoSistemanervoso
Sistemanervoso

O documento descreve o sistema nervoso, incluindo sua organização e funções principais. O sistema nervoso é responsável por perceber estímulos ambientais e corporais e responder a eles. Ele é dividido em sistema nervoso central e periférico, sendo o central composto pelo encéfalo e medula espinhal e o periférico pelos nervos somáticos e autônomos.

Informações Obtidas Através da
Estrutura 3D
 Informações funcionais
   Estudos   sobre   a   natureza     da
    ligação
   Localização da região de ligação


 Seleção  de alvos moleculares
 para o desenvolvimento de
 drogas e vacinas
Modelagem por Homologia
 A ferramenta mais bem sucedida de predição de estruturas
  tridimensionais de proteínas é a modelagem por homologia,
  também conhecida como modelagem comparativa.

 As proteínas agrupam-se em um número limitado de famílias
  tridimensionais. Estima-se que existam cerca de 5.000
  famílias protéicas.

 Conseqüentemente, quando se conhece a estrutura de pelo
  menos um representante de uma família, é geralmente
  possível modelar, por homologia, os demais membros da
  família.
Mioglobina




Em função do número de mutações envolvidas, as
seqüências de aminoácidos de proteínas homólogas podem
ser, idênticas, semelhantes ou dissemelhantes.
Modelagem por Homologia
 Esta abordagem baseia-se em alguns padrões gerais que têm sido
  observados, em nível molecular, no processo de evolução biológica:

   Homologia  entre seqüências de        aminoácidos    implica   em
    semelhança estrutural e funcional;

   Proteínas homólogas apresentam regiões internas conservadas
    (principalmente constituídas de      elementos      de   estrutura
    secundária: -Hélice e -Folhas;

   As principais diferenças estruturais entre proteínas homólogas
    ocorrem nas regiões externas, constituídas principalmente por
    alças ("loops"), que ligam os elementos de estruturas
    secundárias.

Recomendado para você

Poríferos e cnidários
Poríferos e cnidáriosPoríferos e cnidários
Poríferos e cnidários

O documento descreve as funções e características dos poríferos. Os poríferos possuem ósculo, átrio e poros que permitem a circulação da água e nutrientes. Possuem espículas ou espongina que fornecem sustentação e são produzidas por amebócitos. Servem como hábitat para algas e animais e como alimento para peixes.

Bioquímica aplicada à Nanotoxicologia
Bioquímica aplicada à NanotoxicologiaBioquímica aplicada à Nanotoxicologia
Bioquímica aplicada à Nanotoxicologia

O documento descreve um módulo de bioquímica aplicada à nanotoxicologia ministrado por professores da Universidade Federal do Rio Grande. O módulo aborda tópicos como estrutura e função de proteínas, enzimas, lipídios, ciclo de Krebs, fosforilação oxidativa e estrutura de ácidos nucléicos. O documento fornece detalhes sobre a estrutura e função de proteínas e enzimas.

bioquímica nanotoxicologia
Proteínas composição e estrutura
Proteínas composição e estruturaProteínas composição e estrutura
Proteínas composição e estrutura

Proteínas composição e estrutura

Modelagem por Homologia
 A modelagem de uma proteína (proteína-problema)
 pelo método da homologia baseia-se no conceito de
 evolução molecular.

 Isto é, parte-se do princípio de que a semelhança
 entre as estruturas primárias desta proteína e de
 proteínas homólogas de estruturas tridimensionais
 conhecidas (proteínas-molde) implica em similaridade
 estrutural entre elas.
MODELAGEM MOLECULAR POR
  HOMOLOGIA ESTRUTURAL
• Geralmente, o processo de obtenção de um modelo
 protéico virtual através da execução da estratégia da
 modelagem molecular por homologia estrutural
 envolve quatro etapas principais.
Identificação dos moldes

Busca por proteínas Homólogas
                                 Alinhamento de sequências


Alinhamento das seqüências      Construção da cadeia principal
                                   das regiões conservada

  Construção dos modelos
                                    Modelagem das alças

   Validação dos Modelos              Modelo primitivo


                                   Otimização e validação

                                    não            sim
                                            OK?              FIM
Identificação e seleção de proteínas-
   molde
 (a) conhece-se a família protéica a que pertence a
  proteína-problema;
 (b) não se sabe a que família a proteína-problema
  pertence.
 Se o grau de identidade entre as estruturas primárias
  das proteínas-molde e da proteína–problema for igual ou
  superior a cerca de
 25%, quando o número de resíduos é superior a 80,
  existe grande probabilidade de que estas proteínas
  tenham estruturas tridimensionais semelhantes.

Recomendado para você

Aula Proteínas
Aula ProteínasAula Proteínas
Aula Proteínas

O documento descreve as proteínas, incluindo sua estrutura e funções. As proteínas são macromoléculas formadas pela condensação de aminoácidos através de ligações peptídicas. Sua estrutura inclui níveis primário, secundário, terciário e quaternário. As proteínas têm funções como enzimas, hormônios, transporte de oxigênio e estruturais.

protenasestrutura
AULA 3 PROTEINAS - Copia.pdf
AULA 3  PROTEINAS - Copia.pdfAULA 3  PROTEINAS - Copia.pdf
AULA 3 PROTEINAS - Copia.pdf

Desculpe, mas não posso garantir notas específicas em provas. No entanto, farei o meu melhor para responder corretamente às perguntas.

Proteinas
ProteinasProteinas
Proteinas

O documento discute as propriedades estruturais das proteínas, definindo-as como compostos orgânicos complexos formados por aminoácidos. Descreve as quatro estruturas das proteínas (primária, secundária, terciária e quaternária) e exemplos de cada uma. Também classifica as proteínas de acordo com sua forma, função e características moleculares.

Alinhamento das seqüências de
resíduos de aminoácidos
Construção do modelo
 Modelagem     das    regiões      estruturalmente
 conservadas;

 Modelagem das regiões de alças (loop);


 Modelagem das cadeias laterais;


 Otimização do modelo gerado.
Validação do modelo
 A qualidade estereoquímica do modelo é de
 importância fundamental. O programa mais
 utilizado  na    avaliação dos  parâmetros
 estereoquímicos, o PROCHECK.

 O gráfico de Ramachandran é particularmente útil
 porque ele define os resíduos que se encontram
 nas regiões energicamente mais favoráveis e
 desfavoráveis e orienta a avaliação da qualidade
 de modelos teóricos ou experimentais de
 proteínas.
Ramachandran

Recomendado para você

Aminoácidos e proteínas
Aminoácidos e proteínasAminoácidos e proteínas
Aminoácidos e proteínas

Este documento fornece um resumo sobre aminoácidos e proteínas. As proteínas são formadas pela ligação de aminoácidos, existindo 20 tipos principais de aminoácidos. As proteínas desempenham diversas funções vitais como estrutura, contração, transporte, defesa, entre outras. Sua estrutura é definida em níveis primário, secundário, terciário e quaternário.

Metabolismo de construção I - aulas 13 a 15
Metabolismo de construção I - aulas 13 a 15Metabolismo de construção I - aulas 13 a 15
Metabolismo de construção I - aulas 13 a 15

I. O documento discute as proteínas, seus componentes (aminoácidos), estrutura e funções. II. As proteínas são formadas por cadeias de aminoácidos unidos por ligações peptídicas. Sua estrutura e função dependem da sequência específica de aminoácidos. III. Exemplos como a hemoglobina ilustram como mutações em proteínas podem causar doenças.

Aminoácidos e proteínas
Aminoácidos e proteínasAminoácidos e proteínas
Aminoácidos e proteínas

O documento descreve as propriedades dos aminoácidos e sua importância na estrutura e função das proteínas. Resume que aminoácidos são moléculas orgânicas que constituem as unidades estruturais das proteínas e participam de funções celulares. Existem 20 aminoácidos essenciais para humanos que devem ser ingeridos por meio da alimentação.

RMSD
O parâmetro mais comum que expressa a
diferença entre duas estruturas protéicas é o
RMSD, ou desvio médio quadrático, em
posições atômicas entre as duas estruturas.
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia
Calpaínas
   Isoformas (classificação):

    Isoforma     Domínios EF-         Tecido              Doença
                    Hand
Calpaína 1 e 2        +              Ubíquas              AVE, IAM
(µ,m)
Calpaína 3            +              Músculo-         Distrofia muscular
                                    esquelético
Calpaína 6            -          Útero e placenta           SOP
Calpaína 9            +          Aparelho digestivo        Câncer
Calpaína 10           -               Ubíqua              Diabetes




                                                        SILVA, 2012

Recomendado para você

Aula 5.Estudo das proteinas.pptx
Aula 5.Estudo das proteinas.pptxAula 5.Estudo das proteinas.pptx
Aula 5.Estudo das proteinas.pptx

O documento discute a introdução ao estudo de proteínas. Aborda conceitos básicos como estrutura, funções e classificação de proteínas e aminoácidos. Também descreve os diferentes níveis de organização estrutural em proteínas, incluindo estrutura primária, secundária, terciária e quaternária.

Microsoft word -_ciencias_cosmo_terra_vida_online_7_
Microsoft word -_ciencias_cosmo_terra_vida_online_7_Microsoft word -_ciencias_cosmo_terra_vida_online_7_
Microsoft word -_ciencias_cosmo_terra_vida_online_7_

O documento discute a química da vida, incluindo a estrutura e função de moléculas orgânicas como hidratos de carbono, lipídios, proteínas e ácidos nucleicos. Também aborda a estrutura primária, secundária, terciária e quaternária de proteínas, bem como a estrutura e funções de lipídios.

Aula3 lehn04 estrutura3_dproteinas
Aula3 lehn04 estrutura3_dproteinasAula3 lehn04 estrutura3_dproteinas
Aula3 lehn04 estrutura3_dproteinas

A função das proteínas é altamente dependente da sua estruturação tridimensional no espaço. A ligação peptídica é planar; omega = 180°. A estrutura das proteínas se dá principalmente por variações nos ângulos phi e psi. Nem todos os ângulos phi e psi são permitidos, diagrama de ramachandran identifica as posições possíveis. A alfa-hélice é a estrutura secundária mais comum entre as proteínas. Na alfa-hélice temos 3,6 resíduos de aminoácidos por volta, onde a estrutura local é estabilizada por pontes de hidrogênio. As folhas beta são conformações secundárias bastante comuns nas proteínas. As folhas beta podem ser paralelas ou anti-paralelas. As voltas-beta são as pontes que ligam as folhas beta. As proteínas podem ser fibrosas ou globulares. A estrutura terciária das proteínas é formada pela interação global entre os elementos de estrutura secundária no espaço tridimensional (largura, altura, comprimento). As proteínas precisam se enovelar em uma forma nativa, de baixa de energia, para funcionarem bem. A forma mais comum e funcional da proteína enovelada é chamada de forma nativa. Algumas proteínas não são capazes de se enovelar sozinhas e para isso existem complexos multiméricos de proteínas chamadas chaperonas.

estrutura de proteínas
SILVA, 2012
SILVA, 2012
SILVA, 2012
SILVA, 2012

Recomendado para você

Aula 02 proteinas e metabolismo de aa
Aula 02   proteinas e metabolismo de aaAula 02   proteinas e metabolismo de aa
Aula 02 proteinas e metabolismo de aa

O documento discute a estrutura e função das proteínas no corpo humano. As proteínas são compostas por aminoácidos e possuem estrutura primária, secundária, terciária e quaternária. Exemplos importantes como a hemoglobina e as imunoglobulinas são detalhados para ilustrar como as proteínas realizam funções vitais de transporte, catálise e defesa imunológica.

Proteínas - estrutura e funções gerais
Proteínas - estrutura e funções geraisProteínas - estrutura e funções gerais
Proteínas - estrutura e funções gerais

1) Proteínas são macromoléculas essenciais construídas a partir de aminoácidos que exercem diversas funções vitais. 2) Proteínas possuem estruturas primária, secundária, terciária e quaternária que determinam sua forma tridimensional e função. 3) A estrutura terciária de uma proteína é determinada unicamente por sua sequência de aminoácidos, conforme demonstrado no experimento clássico de Anfinsen.

Proteinas
ProteinasProteinas
Proteinas

1) As proteínas são compostos orgânicos sintetizados pelos organismos vivos através da condensação de aminoácidos. 2) As proteínas têm diferentes funções estruturais, como dar rigidez aos tecidos, e funções como transporte de oxigênio e defesa do organismo. 3) As enzimas, que são proteínas, atuam como catalisadores em reações químicas, facilitando as reações no corpo.

SILVA, 2012
SILVA, 2012
OBRIGADO


 www.bioinform




                  Alpha Helix for Linus Pauling (2004)
                    Escultura de Julian Voss-Andreae
                      3 m de altura, revestida de aço.
                                        Portland, EUA

                                Fonte: http://en.wikipedia.org
   B. Rost (2001) Protein secondary structure prediction continues to rise. Journal of
    Structural Biology, 134, pp. 204-218 (Columbia University).
   Bystroff, C., Thorsson, V. & Baker, D. (2000). HMMSTR: a hidden Markov model
    for local sequence-structure correlations in proteins. J. Mol. Biol., 301, 173-190
    (University of Washington)
   Cuff, J. A., Clamp, M. E., Siddiqui, A. S., Finlay, M. & Barton, G. J. (1998). JPred:
    a consensus secondary structure prediction server. Bioinformatics, 14, 892-893
    (JPred – Oxford/Cambridge)
   Cuff, J. A. & Barton, G. J. (2000). Application of multiple sequence alignment
    profiles to improve protein secondary structure prediction. Proteins, 40, 502-511
    (JPred2)
   Rost, B. (1996). PHD: predicting one-dimensional protein structure by profile
    based neural networks. Meth. Enzymol., 266, 525-539. (PHD – Heidelberg –
    Germany)

Recomendado para você

Biologia - Proteínas
Biologia - ProteínasBiologia - Proteínas
Biologia - Proteínas

O documento discute as proteínas, descrevendo-as como macromoléculas complexas resultantes da condensação de aminoácidos. As proteínas podem ter diferentes estruturas e funções, incluindo enzimas, hormônios, proteínas estruturais e de transporte. Sua estrutura primária, secundária, terciária e quaternária conferem estabilidade e permitem que desempenhem suas funções vitais.

Proteínas
ProteínasProteínas
Proteínas

O documento descreve as proteínas e aminoácidos. As proteínas são formadas pela união de aminoácidos através de ligações peptídicas. Existem 20 tipos de aminoácidos que são as unidades estruturais das proteínas. As proteínas possuem estrutura primária, secundária, terciária e quaternária e desempenham funções importantes no corpo como estrutura, transporte, defesa e catalise de reações.

Composição química celular continuação
Composição química celular continuaçãoComposição química celular continuação
Composição química celular continuação

O documento descreve a composição química celular, focando nos lipídios e proteínas. Os lipídios são formados principalmente por ácidos graxos e desempenham funções como reserva energética, isolante térmico e na constituição de membranas celulares. As proteínas são formadas por aminoácidos unidos por ligações peptídicas, e desempenham diversas funções vitais como transporte, defesa e enzimáticas. A atividade das enzimas pode ser influenciada por fatores como temperatura e

Referências
 DonaldVoet; Judith G. Voet; Charlotte W. Pratt, Funadmentos de
  BIOQUÌMICA A vida em nível molecular 2ª ed., 2006.
 Lehninger Principles of Biochemistry
 Princípios de Bioquímica ( Lehninger ) - 4ª edição - LEHNINGER,
  ALBERT L. , COX, NELSON, KAY YARBOROUGH.
 Przybylski, D. & Rost, B. (2000). PSI-BLAST for structure prediction: plug-in
  and win. Columbia University (PHDPsi)
 Rost WWW, B. (2000). Better secondary structure prediction through more
  data.          Columbia          University,        WWW                document
  (http://cubic.bioc.columbia.edu/predictprotein) (PROF)
 Altschul, S., Madden, T., Shaffer, A., Zhang, J., Zhang, Z. et al. (1997). Gapped
  Blast and PSI-Blast: a new generation of protein database search programs.
  Nucl. Acids Res., 25, 3389-3402. (PSI-BLAST – USA)
 Jones, D. T. (1999). Protein secondary structure prediction based on position-
  specific scoring matrices. J. Mol. Biol., 292, 195-202 (PSIPRED – Warwick)

Mais conteúdo relacionado

Mais procurados

Potencial hidrogeniônico (p h)
Potencial hidrogeniônico (p h)Potencial hidrogeniônico (p h)
Potencial hidrogeniônico (p h)
Lucas Molinari
 
Ligações Químicas
Ligações QuímicasLigações Químicas
Ligações Químicas
José Nunes da Silva Jr.
 
Aula 05 membrana plasmática e transportes
Aula 05   membrana plasmática e transportesAula 05   membrana plasmática e transportes
Aula 05 membrana plasmática e transportes
Hamilton Nobrega
 
Genetica forense
Genetica forense Genetica forense
Genetica forense
João Monteiro
 
Aula 12 - Tecnologia do DNA recombinante
Aula 12 - Tecnologia do DNA recombinanteAula 12 - Tecnologia do DNA recombinante
Aula 12 - Tecnologia do DNA recombinante
Fernando Mori Miyazawa
 
Aula molecular 1
Aula molecular 1Aula molecular 1
Aula molecular 1
UERGS
 
Pcr
PcrPcr
II. 2 Carboidratos, lipídios e proteínas
II. 2 Carboidratos, lipídios e proteínasII. 2 Carboidratos, lipídios e proteínas
II. 2 Carboidratos, lipídios e proteínas
Rebeca Vale
 
Eletroforese
EletroforeseEletroforese
Eletroforese
UERGS
 
Química orgânica - Isomeria
Química orgânica - IsomeriaQuímica orgânica - Isomeria
Química orgânica - Isomeria
Francisco Ivanildo
 
Estrategias purificacao analises proteínas
Estrategias purificacao analises proteínasEstrategias purificacao analises proteínas
Estrategias purificacao analises proteínas
kantidio
 
QUIMICA GERAL Aula 01
QUIMICA GERAL Aula 01QUIMICA GERAL Aula 01
QUIMICA GERAL Aula 01
Manim Edições
 
Estequiometria - Prof. Fernando Abreu
Estequiometria - Prof. Fernando AbreuEstequiometria - Prof. Fernando Abreu
Estequiometria - Prof. Fernando Abreu
Fernando Abreu
 
Aula 9 - Metabolismo energético - Respiração celular e Fermentação
Aula 9 - Metabolismo energético - Respiração celular e FermentaçãoAula 9 - Metabolismo energético - Respiração celular e Fermentação
Aula 9 - Metabolismo energético - Respiração celular e Fermentação
Fernando Mori Miyazawa
 
III. 1 Histórico Biotecnologia
III. 1 Histórico BiotecnologiaIII. 1 Histórico Biotecnologia
III. 1 Histórico Biotecnologia
Rebeca Vale
 
ENZIMAS.ppt
ENZIMAS.pptENZIMAS.ppt
ENZIMAS.ppt
MarcusBancilon1
 
Aula sobre-mutacoes
Aula sobre-mutacoesAula sobre-mutacoes
Aula sobre-mutacoes
VINICIUS SILVA DOS SANTOS
 
Estequiometria
EstequiometriaEstequiometria
Estequiometria
José Nunes da Silva Jr.
 
Substituição Eletrofílica Aromática
Substituição Eletrofílica AromáticaSubstituição Eletrofílica Aromática
Substituição Eletrofílica Aromática
José Nunes da Silva Jr.
 
Quimica tabela periodica
Quimica tabela periodicaQuimica tabela periodica
Quimica tabela periodica
Estude Mais
 

Mais procurados (20)

Potencial hidrogeniônico (p h)
Potencial hidrogeniônico (p h)Potencial hidrogeniônico (p h)
Potencial hidrogeniônico (p h)
 
Ligações Químicas
Ligações QuímicasLigações Químicas
Ligações Químicas
 
Aula 05 membrana plasmática e transportes
Aula 05   membrana plasmática e transportesAula 05   membrana plasmática e transportes
Aula 05 membrana plasmática e transportes
 
Genetica forense
Genetica forense Genetica forense
Genetica forense
 
Aula 12 - Tecnologia do DNA recombinante
Aula 12 - Tecnologia do DNA recombinanteAula 12 - Tecnologia do DNA recombinante
Aula 12 - Tecnologia do DNA recombinante
 
Aula molecular 1
Aula molecular 1Aula molecular 1
Aula molecular 1
 
Pcr
PcrPcr
Pcr
 
II. 2 Carboidratos, lipídios e proteínas
II. 2 Carboidratos, lipídios e proteínasII. 2 Carboidratos, lipídios e proteínas
II. 2 Carboidratos, lipídios e proteínas
 
Eletroforese
EletroforeseEletroforese
Eletroforese
 
Química orgânica - Isomeria
Química orgânica - IsomeriaQuímica orgânica - Isomeria
Química orgânica - Isomeria
 
Estrategias purificacao analises proteínas
Estrategias purificacao analises proteínasEstrategias purificacao analises proteínas
Estrategias purificacao analises proteínas
 
QUIMICA GERAL Aula 01
QUIMICA GERAL Aula 01QUIMICA GERAL Aula 01
QUIMICA GERAL Aula 01
 
Estequiometria - Prof. Fernando Abreu
Estequiometria - Prof. Fernando AbreuEstequiometria - Prof. Fernando Abreu
Estequiometria - Prof. Fernando Abreu
 
Aula 9 - Metabolismo energético - Respiração celular e Fermentação
Aula 9 - Metabolismo energético - Respiração celular e FermentaçãoAula 9 - Metabolismo energético - Respiração celular e Fermentação
Aula 9 - Metabolismo energético - Respiração celular e Fermentação
 
III. 1 Histórico Biotecnologia
III. 1 Histórico BiotecnologiaIII. 1 Histórico Biotecnologia
III. 1 Histórico Biotecnologia
 
ENZIMAS.ppt
ENZIMAS.pptENZIMAS.ppt
ENZIMAS.ppt
 
Aula sobre-mutacoes
Aula sobre-mutacoesAula sobre-mutacoes
Aula sobre-mutacoes
 
Estequiometria
EstequiometriaEstequiometria
Estequiometria
 
Substituição Eletrofílica Aromática
Substituição Eletrofílica AromáticaSubstituição Eletrofílica Aromática
Substituição Eletrofílica Aromática
 
Quimica tabela periodica
Quimica tabela periodicaQuimica tabela periodica
Quimica tabela periodica
 

Destaque

Controle hormonal do ciclo menstrual
Controle hormonal do ciclo menstrualControle hormonal do ciclo menstrual
Controle hormonal do ciclo menstrual
Fabiano Reis
 
Genética – 2 lei de mendel
Genética – 2 lei de mendelGenética – 2 lei de mendel
Genética – 2 lei de mendel
Fabiano Reis
 
Bioestatistica basica completa-apresentacao
Bioestatistica basica completa-apresentacaoBioestatistica basica completa-apresentacao
Bioestatistica basica completa-apresentacao
Fabiano Reis
 
SISTEMA DIGESTORIO
SISTEMA DIGESTORIOSISTEMA DIGESTORIO
SISTEMA DIGESTORIO
jorgeluisbio
 
áCidos nucléicos slides
áCidos nucléicos slidesáCidos nucléicos slides
áCidos nucléicos slides
Fabiano Reis
 
Bioquimica
BioquimicaBioquimica
Bioquimica
Fabiano Reis
 
Aula 06 Sistema nervoso e sensorial - anatomia
Aula 06   Sistema nervoso e sensorial - anatomiaAula 06   Sistema nervoso e sensorial - anatomia
Aula 06 Sistema nervoso e sensorial - anatomia
Hamilton Nobrega
 
Genética probabilidade slides
Genética probabilidade slidesGenética probabilidade slides
Genética probabilidade slides
Fabiano Reis
 
Genética probabilidade slides
Genética probabilidade slidesGenética probabilidade slides
Genética probabilidade slides
Fabiano Reis
 
Taxonomia
TaxonomiaTaxonomia
Taxonomia
Fabiano Reis
 
Embriologia
EmbriologiaEmbriologia
Embriologia
Fabiano Reis
 
Sistema reprodutor feminino
Sistema reprodutor femininoSistema reprodutor feminino
Sistema reprodutor feminino
Fabiano Reis
 
Introdução à Anatomia e Fisiologia Humana
Introdução à Anatomia e Fisiologia HumanaIntrodução à Anatomia e Fisiologia Humana
Introdução à Anatomia e Fisiologia Humana
Eiderson Silva Cabral
 
Morfologia externa das angiospermas
Morfologia externa das angiospermasMorfologia externa das angiospermas
Morfologia externa das angiospermas
Fabiano Reis
 
Sistema DigestóRio
Sistema DigestóRioSistema DigestóRio
Sistema DigestóRio
kazumialexandre
 
Bioquimica
BioquimicaBioquimica
Bioquimica
Fabiano Reis
 
Genética – leis de mendel slides
Genética – leis de mendel slidesGenética – leis de mendel slides
Genética – leis de mendel slides
Fabiano Reis
 
Platelmintos
PlatelmintosPlatelmintos
Platelmintos
Fabiano Reis
 
Sistemanervoso
SistemanervosoSistemanervoso
Sistemanervoso
thaissa_yagami
 
Poríferos e cnidários
Poríferos e cnidáriosPoríferos e cnidários
Poríferos e cnidários
Fabiano Reis
 

Destaque (20)

Controle hormonal do ciclo menstrual
Controle hormonal do ciclo menstrualControle hormonal do ciclo menstrual
Controle hormonal do ciclo menstrual
 
Genética – 2 lei de mendel
Genética – 2 lei de mendelGenética – 2 lei de mendel
Genética – 2 lei de mendel
 
Bioestatistica basica completa-apresentacao
Bioestatistica basica completa-apresentacaoBioestatistica basica completa-apresentacao
Bioestatistica basica completa-apresentacao
 
SISTEMA DIGESTORIO
SISTEMA DIGESTORIOSISTEMA DIGESTORIO
SISTEMA DIGESTORIO
 
áCidos nucléicos slides
áCidos nucléicos slidesáCidos nucléicos slides
áCidos nucléicos slides
 
Bioquimica
BioquimicaBioquimica
Bioquimica
 
Aula 06 Sistema nervoso e sensorial - anatomia
Aula 06   Sistema nervoso e sensorial - anatomiaAula 06   Sistema nervoso e sensorial - anatomia
Aula 06 Sistema nervoso e sensorial - anatomia
 
Genética probabilidade slides
Genética probabilidade slidesGenética probabilidade slides
Genética probabilidade slides
 
Genética probabilidade slides
Genética probabilidade slidesGenética probabilidade slides
Genética probabilidade slides
 
Taxonomia
TaxonomiaTaxonomia
Taxonomia
 
Embriologia
EmbriologiaEmbriologia
Embriologia
 
Sistema reprodutor feminino
Sistema reprodutor femininoSistema reprodutor feminino
Sistema reprodutor feminino
 
Introdução à Anatomia e Fisiologia Humana
Introdução à Anatomia e Fisiologia HumanaIntrodução à Anatomia e Fisiologia Humana
Introdução à Anatomia e Fisiologia Humana
 
Morfologia externa das angiospermas
Morfologia externa das angiospermasMorfologia externa das angiospermas
Morfologia externa das angiospermas
 
Sistema DigestóRio
Sistema DigestóRioSistema DigestóRio
Sistema DigestóRio
 
Bioquimica
BioquimicaBioquimica
Bioquimica
 
Genética – leis de mendel slides
Genética – leis de mendel slidesGenética – leis de mendel slides
Genética – leis de mendel slides
 
Platelmintos
PlatelmintosPlatelmintos
Platelmintos
 
Sistemanervoso
SistemanervosoSistemanervoso
Sistemanervoso
 
Poríferos e cnidários
Poríferos e cnidáriosPoríferos e cnidários
Poríferos e cnidários
 

Semelhante a Aula teorica minicurso modelagem de proteinas por homologia

Bioquímica aplicada à Nanotoxicologia
Bioquímica aplicada à NanotoxicologiaBioquímica aplicada à Nanotoxicologia
Bioquímica aplicada à Nanotoxicologia
Rede Nacional de Nanotoxicologia (CNPq)
 
Proteínas composição e estrutura
Proteínas composição e estruturaProteínas composição e estrutura
Proteínas composição e estrutura
Alpha Colégio e Vestibulares
 
Aula Proteínas
Aula ProteínasAula Proteínas
Aula Proteínas
Daniele Teixeira
 
AULA 3 PROTEINAS - Copia.pdf
AULA 3  PROTEINAS - Copia.pdfAULA 3  PROTEINAS - Copia.pdf
AULA 3 PROTEINAS - Copia.pdf
MikaelCau1
 
Proteinas
ProteinasProteinas
Proteinas
antonio Junior
 
Aminoácidos e proteínas
Aminoácidos e proteínasAminoácidos e proteínas
Aminoácidos e proteínas
Adrianne Mendonça
 
Metabolismo de construção I - aulas 13 a 15
Metabolismo de construção I - aulas 13 a 15Metabolismo de construção I - aulas 13 a 15
Metabolismo de construção I - aulas 13 a 15
Alpha Colégio e Vestibulares
 
Aminoácidos e proteínas
Aminoácidos e proteínasAminoácidos e proteínas
Aminoácidos e proteínas
Luis Ribeiro
 
Aula 5.Estudo das proteinas.pptx
Aula 5.Estudo das proteinas.pptxAula 5.Estudo das proteinas.pptx
Aula 5.Estudo das proteinas.pptx
CarlosMacuvele2
 
Microsoft word -_ciencias_cosmo_terra_vida_online_7_
Microsoft word -_ciencias_cosmo_terra_vida_online_7_Microsoft word -_ciencias_cosmo_terra_vida_online_7_
Microsoft word -_ciencias_cosmo_terra_vida_online_7_
sandraantunes
 
Aula3 lehn04 estrutura3_dproteinas
Aula3 lehn04 estrutura3_dproteinasAula3 lehn04 estrutura3_dproteinas
Aula3 lehn04 estrutura3_dproteinas
Francisco Prosdocimi
 
Aula 02 proteinas e metabolismo de aa
Aula 02   proteinas e metabolismo de aaAula 02   proteinas e metabolismo de aa
Aula 02 proteinas e metabolismo de aa
Vinicius Trajano
 
Proteínas - estrutura e funções gerais
Proteínas - estrutura e funções geraisProteínas - estrutura e funções gerais
Proteínas - estrutura e funções gerais
krirocha
 
Proteinas
ProteinasProteinas
Biologia - Proteínas
Biologia - ProteínasBiologia - Proteínas
Biologia - Proteínas
Carson Souza
 
Proteínas
ProteínasProteínas
Composição química celular continuação
Composição química celular continuaçãoComposição química celular continuação
Composição química celular continuação
profatatiana
 
Proteinas
ProteinasProteinas
Proteinas
merciavaz
 
Bioquimica_Aula_Introdutória.ppt
Bioquimica_Aula_Introdutória.pptBioquimica_Aula_Introdutória.ppt
Bioquimica_Aula_Introdutória.ppt
Tiago dos Reis Almeida
 
PróTidos
PróTidosPróTidos
PróTidos
Tânia Reis
 

Semelhante a Aula teorica minicurso modelagem de proteinas por homologia (20)

Bioquímica aplicada à Nanotoxicologia
Bioquímica aplicada à NanotoxicologiaBioquímica aplicada à Nanotoxicologia
Bioquímica aplicada à Nanotoxicologia
 
Proteínas composição e estrutura
Proteínas composição e estruturaProteínas composição e estrutura
Proteínas composição e estrutura
 
Aula Proteínas
Aula ProteínasAula Proteínas
Aula Proteínas
 
AULA 3 PROTEINAS - Copia.pdf
AULA 3  PROTEINAS - Copia.pdfAULA 3  PROTEINAS - Copia.pdf
AULA 3 PROTEINAS - Copia.pdf
 
Proteinas
ProteinasProteinas
Proteinas
 
Aminoácidos e proteínas
Aminoácidos e proteínasAminoácidos e proteínas
Aminoácidos e proteínas
 
Metabolismo de construção I - aulas 13 a 15
Metabolismo de construção I - aulas 13 a 15Metabolismo de construção I - aulas 13 a 15
Metabolismo de construção I - aulas 13 a 15
 
Aminoácidos e proteínas
Aminoácidos e proteínasAminoácidos e proteínas
Aminoácidos e proteínas
 
Aula 5.Estudo das proteinas.pptx
Aula 5.Estudo das proteinas.pptxAula 5.Estudo das proteinas.pptx
Aula 5.Estudo das proteinas.pptx
 
Microsoft word -_ciencias_cosmo_terra_vida_online_7_
Microsoft word -_ciencias_cosmo_terra_vida_online_7_Microsoft word -_ciencias_cosmo_terra_vida_online_7_
Microsoft word -_ciencias_cosmo_terra_vida_online_7_
 
Aula3 lehn04 estrutura3_dproteinas
Aula3 lehn04 estrutura3_dproteinasAula3 lehn04 estrutura3_dproteinas
Aula3 lehn04 estrutura3_dproteinas
 
Aula 02 proteinas e metabolismo de aa
Aula 02   proteinas e metabolismo de aaAula 02   proteinas e metabolismo de aa
Aula 02 proteinas e metabolismo de aa
 
Proteínas - estrutura e funções gerais
Proteínas - estrutura e funções geraisProteínas - estrutura e funções gerais
Proteínas - estrutura e funções gerais
 
Proteinas
ProteinasProteinas
Proteinas
 
Biologia - Proteínas
Biologia - ProteínasBiologia - Proteínas
Biologia - Proteínas
 
Proteínas
ProteínasProteínas
Proteínas
 
Composição química celular continuação
Composição química celular continuaçãoComposição química celular continuação
Composição química celular continuação
 
Proteinas
ProteinasProteinas
Proteinas
 
Bioquimica_Aula_Introdutória.ppt
Bioquimica_Aula_Introdutória.pptBioquimica_Aula_Introdutória.ppt
Bioquimica_Aula_Introdutória.ppt
 
PróTidos
PróTidosPróTidos
PróTidos
 

Mais de Fabiano Reis

Ciclos de vida dos vegetais
Ciclos de vida dos vegetaisCiclos de vida dos vegetais
Ciclos de vida dos vegetais
Fabiano Reis
 
Histologia vegetal
Histologia vegetalHistologia vegetal
Histologia vegetal
Fabiano Reis
 
Sistema reprodutor masculino
Sistema reprodutor masculinoSistema reprodutor masculino
Sistema reprodutor masculino
Fabiano Reis
 
Sistema nervoso slides
Sistema nervoso slidesSistema nervoso slides
Sistema nervoso slides
Fabiano Reis
 
Sistema endócrino slides da aula
Sistema endócrino slides da aulaSistema endócrino slides da aula
Sistema endócrino slides da aula
Fabiano Reis
 
Genética probabilidade slides
Genética probabilidade slidesGenética probabilidade slides
Genética probabilidade slides
Fabiano Reis
 
Genética probabilidade slides
Genética probabilidade slidesGenética probabilidade slides
Genética probabilidade slides
Fabiano Reis
 
Sistema digestorio slides
Sistema digestorio slidesSistema digestorio slides
Sistema digestorio slides
Fabiano Reis
 
Sistema digestorio slides
Sistema digestorio slidesSistema digestorio slides
Sistema digestorio slides
Fabiano Reis
 
Sistema urinario apresentação de slides
Sistema urinario apresentação de slidesSistema urinario apresentação de slides
Sistema urinario apresentação de slides
Fabiano Reis
 
Sistema circulatorio slides da aula
Sistema circulatorio slides da aulaSistema circulatorio slides da aula
Sistema circulatorio slides da aula
Fabiano Reis
 
Sistema respiratorio slides da aula
Sistema respiratorio slides da aulaSistema respiratorio slides da aula
Sistema respiratorio slides da aula
Fabiano Reis
 
Introdução ao estudo da citologia slides
Introdução ao estudo da citologia slidesIntrodução ao estudo da citologia slides
Introdução ao estudo da citologia slides
Fabiano Reis
 
Genética parte1
Genética parte1Genética parte1
Genética parte1
Fabiano Reis
 
Slides estudo das mutaçoes
Slides estudo das mutaçoesSlides estudo das mutaçoes
Slides estudo das mutaçoes
Fabiano Reis
 

Mais de Fabiano Reis (15)

Ciclos de vida dos vegetais
Ciclos de vida dos vegetaisCiclos de vida dos vegetais
Ciclos de vida dos vegetais
 
Histologia vegetal
Histologia vegetalHistologia vegetal
Histologia vegetal
 
Sistema reprodutor masculino
Sistema reprodutor masculinoSistema reprodutor masculino
Sistema reprodutor masculino
 
Sistema nervoso slides
Sistema nervoso slidesSistema nervoso slides
Sistema nervoso slides
 
Sistema endócrino slides da aula
Sistema endócrino slides da aulaSistema endócrino slides da aula
Sistema endócrino slides da aula
 
Genética probabilidade slides
Genética probabilidade slidesGenética probabilidade slides
Genética probabilidade slides
 
Genética probabilidade slides
Genética probabilidade slidesGenética probabilidade slides
Genética probabilidade slides
 
Sistema digestorio slides
Sistema digestorio slidesSistema digestorio slides
Sistema digestorio slides
 
Sistema digestorio slides
Sistema digestorio slidesSistema digestorio slides
Sistema digestorio slides
 
Sistema urinario apresentação de slides
Sistema urinario apresentação de slidesSistema urinario apresentação de slides
Sistema urinario apresentação de slides
 
Sistema circulatorio slides da aula
Sistema circulatorio slides da aulaSistema circulatorio slides da aula
Sistema circulatorio slides da aula
 
Sistema respiratorio slides da aula
Sistema respiratorio slides da aulaSistema respiratorio slides da aula
Sistema respiratorio slides da aula
 
Introdução ao estudo da citologia slides
Introdução ao estudo da citologia slidesIntrodução ao estudo da citologia slides
Introdução ao estudo da citologia slides
 
Genética parte1
Genética parte1Genética parte1
Genética parte1
 
Slides estudo das mutaçoes
Slides estudo das mutaçoesSlides estudo das mutaçoes
Slides estudo das mutaçoes
 

Último

STALINISMO apresentação slides para escolares
STALINISMO apresentação slides para escolaresSTALINISMO apresentação slides para escolares
STALINISMO apresentação slides para escolares
Daniel273024
 
Relatório de Atividades 2017 CENSIPAM.pdf
Relatório de Atividades 2017 CENSIPAM.pdfRelatório de Atividades 2017 CENSIPAM.pdf
Relatório de Atividades 2017 CENSIPAM.pdf
Falcão Brasil
 
Noite Alva! José Ernesto Ferraresso.ppsx
Noite Alva! José Ernesto Ferraresso.ppsxNoite Alva! José Ernesto Ferraresso.ppsx
Noite Alva! José Ernesto Ferraresso.ppsx
Luzia Gabriele
 
Resolução do Exame de Biologia UEM - 2008.
Resolução do Exame de Biologia UEM - 2008.Resolução do Exame de Biologia UEM - 2008.
Resolução do Exame de Biologia UEM - 2008.
mozalgebrista
 
Temática – Projeto para Empreendedores Locais
Temática – Projeto para Empreendedores LocaisTemática – Projeto para Empreendedores Locais
Temática – Projeto para Empreendedores Locais
Colaborar Educacional
 
Relatório de Atividades 2009 CENSIPAM
Relatório de Atividades 2009 CENSIPAM Relatório de Atividades 2009 CENSIPAM
Relatório de Atividades 2009 CENSIPAM
Falcão Brasil
 
Relatório de Atividades 2016 CENSIPAM.pdf
Relatório de Atividades 2016 CENSIPAM.pdfRelatório de Atividades 2016 CENSIPAM.pdf
Relatório de Atividades 2016 CENSIPAM.pdf
Falcão Brasil
 
Texto e atividade - Fontes alternativas de energia
Texto e atividade -  Fontes alternativas de energiaTexto e atividade -  Fontes alternativas de energia
Texto e atividade - Fontes alternativas de energia
Mary Alvarenga
 
Caça-palavras e cruzadinha - Encontros consonantais.
Caça-palavras e cruzadinha -  Encontros consonantais.Caça-palavras e cruzadinha -  Encontros consonantais.
Caça-palavras e cruzadinha - Encontros consonantais.
Mary Alvarenga
 
A EDUCAÇÃO COM A INTELIGÊNCIA ARTIFICIAL E AS DEFICIÊNCIAS DE SUA APLICAÇÃO N...
A EDUCAÇÃO COM A INTELIGÊNCIA ARTIFICIAL E AS DEFICIÊNCIAS DE SUA APLICAÇÃO N...A EDUCAÇÃO COM A INTELIGÊNCIA ARTIFICIAL E AS DEFICIÊNCIAS DE SUA APLICAÇÃO N...
A EDUCAÇÃO COM A INTELIGÊNCIA ARTIFICIAL E AS DEFICIÊNCIAS DE SUA APLICAÇÃO N...
Faga1939
 
Apostila em LIBRAS - Curso Básico ENAP 2019.pdf
Apostila em LIBRAS - Curso Básico ENAP 2019.pdfApostila em LIBRAS - Curso Básico ENAP 2019.pdf
Apostila em LIBRAS - Curso Básico ENAP 2019.pdf
pattyhsilva271204
 
As Ideias Têm Consequências - Richard M. Weaver
As Ideias Têm Consequências - Richard M. WeaverAs Ideias Têm Consequências - Richard M. Weaver
As Ideias Têm Consequências - Richard M. Weaver
C4io99
 
Infografia | Presidência húngara do Conselho da UE
Infografia | Presidência húngara do Conselho da UEInfografia | Presidência húngara do Conselho da UE
Infografia | Presidência húngara do Conselho da UE
Centro Jacques Delors
 
(45-ESTUDO - LUCAS) A EPIRITUALIDADE DE JESUS
(45-ESTUDO - LUCAS) A EPIRITUALIDADE DE JESUS(45-ESTUDO - LUCAS) A EPIRITUALIDADE DE JESUS
(45-ESTUDO - LUCAS) A EPIRITUALIDADE DE JESUS
Pr Davi Passos - Estudos Bíblicos
 
Slides Lição 2, CPAD, O Livro de Rute, 3Tr24.pptx
Slides Lição 2, CPAD, O Livro de Rute, 3Tr24.pptxSlides Lição 2, CPAD, O Livro de Rute, 3Tr24.pptx
Slides Lição 2, CPAD, O Livro de Rute, 3Tr24.pptx
LuizHenriquedeAlmeid6
 
Ideais do Ministério jovem Adventista pdf
Ideais do Ministério jovem Adventista pdfIdeais do Ministério jovem Adventista pdf
Ideais do Ministério jovem Adventista pdf
Anesio2
 
Aprendizagem Imersiva: Conceitos e Caminhos
Aprendizagem Imersiva: Conceitos e CaminhosAprendizagem Imersiva: Conceitos e Caminhos
Aprendizagem Imersiva: Conceitos e Caminhos
Leonel Morgado
 
Relatório de Atividades 2021/2022 CENSIPAM.pdf
Relatório de Atividades 2021/2022 CENSIPAM.pdfRelatório de Atividades 2021/2022 CENSIPAM.pdf
Relatório de Atividades 2021/2022 CENSIPAM.pdf
Falcão Brasil
 
escrita criativa utilizada na arteterapia
escrita criativa   utilizada na arteterapiaescrita criativa   utilizada na arteterapia
escrita criativa utilizada na arteterapia
shirleisousa9166
 
Caça - palavras e cruzadinha com dígrafos
Caça - palavras  e cruzadinha   com  dígrafosCaça - palavras  e cruzadinha   com  dígrafos
Caça - palavras e cruzadinha com dígrafos
Mary Alvarenga
 

Último (20)

STALINISMO apresentação slides para escolares
STALINISMO apresentação slides para escolaresSTALINISMO apresentação slides para escolares
STALINISMO apresentação slides para escolares
 
Relatório de Atividades 2017 CENSIPAM.pdf
Relatório de Atividades 2017 CENSIPAM.pdfRelatório de Atividades 2017 CENSIPAM.pdf
Relatório de Atividades 2017 CENSIPAM.pdf
 
Noite Alva! José Ernesto Ferraresso.ppsx
Noite Alva! José Ernesto Ferraresso.ppsxNoite Alva! José Ernesto Ferraresso.ppsx
Noite Alva! José Ernesto Ferraresso.ppsx
 
Resolução do Exame de Biologia UEM - 2008.
Resolução do Exame de Biologia UEM - 2008.Resolução do Exame de Biologia UEM - 2008.
Resolução do Exame de Biologia UEM - 2008.
 
Temática – Projeto para Empreendedores Locais
Temática – Projeto para Empreendedores LocaisTemática – Projeto para Empreendedores Locais
Temática – Projeto para Empreendedores Locais
 
Relatório de Atividades 2009 CENSIPAM
Relatório de Atividades 2009 CENSIPAM Relatório de Atividades 2009 CENSIPAM
Relatório de Atividades 2009 CENSIPAM
 
Relatório de Atividades 2016 CENSIPAM.pdf
Relatório de Atividades 2016 CENSIPAM.pdfRelatório de Atividades 2016 CENSIPAM.pdf
Relatório de Atividades 2016 CENSIPAM.pdf
 
Texto e atividade - Fontes alternativas de energia
Texto e atividade -  Fontes alternativas de energiaTexto e atividade -  Fontes alternativas de energia
Texto e atividade - Fontes alternativas de energia
 
Caça-palavras e cruzadinha - Encontros consonantais.
Caça-palavras e cruzadinha -  Encontros consonantais.Caça-palavras e cruzadinha -  Encontros consonantais.
Caça-palavras e cruzadinha - Encontros consonantais.
 
A EDUCAÇÃO COM A INTELIGÊNCIA ARTIFICIAL E AS DEFICIÊNCIAS DE SUA APLICAÇÃO N...
A EDUCAÇÃO COM A INTELIGÊNCIA ARTIFICIAL E AS DEFICIÊNCIAS DE SUA APLICAÇÃO N...A EDUCAÇÃO COM A INTELIGÊNCIA ARTIFICIAL E AS DEFICIÊNCIAS DE SUA APLICAÇÃO N...
A EDUCAÇÃO COM A INTELIGÊNCIA ARTIFICIAL E AS DEFICIÊNCIAS DE SUA APLICAÇÃO N...
 
Apostila em LIBRAS - Curso Básico ENAP 2019.pdf
Apostila em LIBRAS - Curso Básico ENAP 2019.pdfApostila em LIBRAS - Curso Básico ENAP 2019.pdf
Apostila em LIBRAS - Curso Básico ENAP 2019.pdf
 
As Ideias Têm Consequências - Richard M. Weaver
As Ideias Têm Consequências - Richard M. WeaverAs Ideias Têm Consequências - Richard M. Weaver
As Ideias Têm Consequências - Richard M. Weaver
 
Infografia | Presidência húngara do Conselho da UE
Infografia | Presidência húngara do Conselho da UEInfografia | Presidência húngara do Conselho da UE
Infografia | Presidência húngara do Conselho da UE
 
(45-ESTUDO - LUCAS) A EPIRITUALIDADE DE JESUS
(45-ESTUDO - LUCAS) A EPIRITUALIDADE DE JESUS(45-ESTUDO - LUCAS) A EPIRITUALIDADE DE JESUS
(45-ESTUDO - LUCAS) A EPIRITUALIDADE DE JESUS
 
Slides Lição 2, CPAD, O Livro de Rute, 3Tr24.pptx
Slides Lição 2, CPAD, O Livro de Rute, 3Tr24.pptxSlides Lição 2, CPAD, O Livro de Rute, 3Tr24.pptx
Slides Lição 2, CPAD, O Livro de Rute, 3Tr24.pptx
 
Ideais do Ministério jovem Adventista pdf
Ideais do Ministério jovem Adventista pdfIdeais do Ministério jovem Adventista pdf
Ideais do Ministério jovem Adventista pdf
 
Aprendizagem Imersiva: Conceitos e Caminhos
Aprendizagem Imersiva: Conceitos e CaminhosAprendizagem Imersiva: Conceitos e Caminhos
Aprendizagem Imersiva: Conceitos e Caminhos
 
Relatório de Atividades 2021/2022 CENSIPAM.pdf
Relatório de Atividades 2021/2022 CENSIPAM.pdfRelatório de Atividades 2021/2022 CENSIPAM.pdf
Relatório de Atividades 2021/2022 CENSIPAM.pdf
 
escrita criativa utilizada na arteterapia
escrita criativa   utilizada na arteterapiaescrita criativa   utilizada na arteterapia
escrita criativa utilizada na arteterapia
 
Caça - palavras e cruzadinha com dígrafos
Caça - palavras  e cruzadinha   com  dígrafosCaça - palavras  e cruzadinha   com  dígrafos
Caça - palavras e cruzadinha com dígrafos
 

Aula teorica minicurso modelagem de proteinas por homologia

  • 1. Introdução à Modelagem de Proteínas por Homologia MSc. Ronaldo Correia Genética e Biologia Molecular - Bioinformática Laboratório de Planejamento e Desenvolvimento de Fármacos – LPDF - UFPa Belém-PA Novembro de 2012
  • 2. Objetivos  Oferecer noções básicas sobre Proteínas;  Apresentar técnicas de modelagem de Proteínas;  Discutir a importância dessas técnicas para o proteoma e planejamento de fármacos.
  • 3. Introdução Bioinformática Proteínas Métodos Métodos experimentais Teóricos
  • 5. Seres protéicos  A vida está intimamente ligada às proteínas. Estas moléculas especiais realizam as mais variadas funções no nosso organismo tais como:  Transporte de nutrientes e metabólitos, catálise de reações biológicas;  Apesar da complexidade de suas funções, as proteínas são relativamente simples;  Repetições de 20 unidades básicas, os aminoácidos.
  • 6. Proteínas x Meio Ambiente  Metano: 25 x maior potencial efeito estufa que CO2  As arqueias metanogênicas são responsáveis por 74% do metano liberado em nossa atmosfera.  Metil coenzima redutase (MCR): catálise da metanogênese. LIMA, 2012
  • 7. Proteínas x Meio Ambiente LIMA, 2012
  • 9. Aminoácido  Um aminoácido consiste em um caborno “central” com uma ligação a grupo amino (-NH2), outra a um grupo carboxila (-COOH), a terceira a um átomo de hidrogênio e a quarta a uma cadeia lateral variável Carbono α
  • 10. Asparagina Ácido Aspartico Tirosina Fenilalanina
  • 11. Aminoácidos  Single- & three-letter amino acid codes  G Glycine Gly P Proline Pro  A Alanine Ala V Valine Val  L Leucine Leu I Isoleucine Ile  M Methionine Met C Cysteine Cys  F Phenylalanine Phe Y Tyrosine Tyr  W Tryptophan Trp H Histidine His  K Lysine Lys R Arginine Arg  Q Glutamine Gln N Asparagine Asn  E Glutamic Acid Glu D Aspartic Acid Asp  S Serine Ser T Threonine Thr
  • 12. Classificação dos aminoácidos  Os aminoácidos podem ser classificados de acordo com o grupo R como:  Alifáticos (não polares) – sem polos,sem carga;  Não carregados, polares – mas com eminência;  Carregados positivamente;  Carregados Negativamente.
  • 14. O2 presente (possui pólos) para fazer ligações com carbono e hidrogênio.
  • 17. Ligação Peptídica  Os peptídeos são biomoléculas formadas pela ligação de dois ou mais aminoácidos através de ligações do tipo amida. Os peptídeos são resultantes do processamento de proteínas e podem variar de 2 ou mais aminoácidos. 2 aminoácidos: Dipeptídeo 3 aminoácidos: Tripeptídeo 4 a 10 aminoácidos: Oligopeptídeo 10 a 100 aminoácidos: Polipeptídeo mais de 100 aminoácidos: Proteína
  • 18. Vasopressina (ADH) oxitocina ou ocitocina. 9 aminoácidos 9 aminoácidos Insulina Glucagon 51 amino ácidos 29 amino ácidos
  • 21. Interações não covalentes  Ligação de Hidrogênio Ponte de H formada entre duas moléculas de água
  • 23. Low Barrier Hydrogen Bond (LBHB)  Ligação de Hidrogênio
  • 24. Interações de van der Waals
  • 25. Interação Hidrofóbica Gotas de óleo na água
  • 26. Ponte de Dissulfeto Grupo sulfidril
  • 28. Resíduo % Cysteine 17.5 Serine 11.7 Glutamic acid 11.1 Threonine 6.9 Glycine 6.5 Leucine 6.1 Valine 5.9 Arginine 5.6 Aspartic acid 5.0 Alanine 4.8 Proline 3.6 Isoleucine 2.7 Tyrosine 1.9 Phenylalanine 1.4 Histidine 0.8
  • 29.  Covalent Bond ~ 50 - 100kcal/mol  Ionic Bond ~ 5 - 80kcal/mol  Hydrogen Bond ~ 3 - 6kcal/mol  Hydrophobic Interaction ~ 0.5 - 3kcal/mol (not a bond per se)  Van der Waals Interaction ~ 1kcal/mol
  • 30. Proteínas  Definição: são macromoléculas complexas, compostas de aminoácidos, e necessárias para os processos químicos que ocorrem nos organismos vivos  Nos animais, as proteínas correspondem a cerca de 80% do peso dos músculos desidratados, cerca de 70% da pele e 90% do sangue seco.
  • 31. Estrutura Primária amino terminal ou "N-terminal" (NH3+) carboxi terminal ("C-terminal") (COO-)
  • 32. FASTA >2ANL:A|PDBID|CHAIN|SEQUENCE SENDVIELDDVANLMFYGEGEVGDNHQKFMLIFDTGSANLWVPS KCNSIGCSTKHLYDSSKSKSYEKDGTKVEITYGSGVRGFFSKDLVT LGYLSLPYKFIEVTDTDDLEPLYTAAEFDGILGLGWKDLSIGSIDPI VVELKNQNKIDQALFTFYLPVHDKHSGYLTIGGIEEKFYEGELTYE KLNHDLFWQVDLDVNFGKTSMEKANVIVDSGTSTITAPTSFINKFF KDLNVIKVPFLPFYITTCNNKDMPTLEFKSANNTYTLEPEYYMEPL LDIDDTLCMLYILPVDIDKNTFILGDPFMRKYFTVFDYDKESIGFAV AKN
  • 33. Estrutura Secundária  A estrutura secundária é uma função dos ângulos formados pelas ligações peptídicas que ligam os aminoácidos  A conformação espacial é mantida graças as interações intermoleculares (ligação hidrogênio) entre os hidrogênios dos grupos amino e os átomos de oxigênio dos outros amino ácidos.
  • 34. -Hélice  É a forma mais comum de estrutura secundária regular;  Caracteriza-se por uma hélice em espiral formada por volta de 3 a 6 aminoácidos;  As cadeias laterais dos aminoácidos se distribuem para fora da hélice  A principal força de estabilização da a - Hélice é a ponte de hidrogênio.
  • 35. -Folhas  Envolve 2 ou mais segmentos polipeptídicos da mesma molécula ou de moléculas diferentes, arranjados em paralelo ou no sentido anti- paralelo  Os segmentos em folha da proteína adquirem um aspecto de uma folha de papel dobrada em pregas.  As pontes de hidrogênio mais uma vez são a força de estabilização principal desta estrutura
  • 38. Qual seria Beta Folha?
  • 39. Estrutura Terciária  A estrutura terciária relaciona-se com os loopings e dobraduras da cadeia protéica sobre ela mesma.  É a conformação espacial da proteína, como um todo, e não de determinados segmentos particulares da cadeia protéica.  A forma das proteínas está relacionada com sua estrutura terciária.
  • 40. Estrutura Terciária -Folhas Loop -Hélice 2CBJ
  • 44. Previsão de Estrutura de Proteínas Raios X Cerca de 10 a 14 mil estruturas em repositórios públicos Experimental 102.000 mil estruturas RMN primárias Homologia Teórico Ab initio
  • 46. Por que modelar proteínas?  Dificuldade em se obter estruturas experimentais;  Custo elevado
  • 47. Por que modelar proteínas?
  • 48. Informações Obtidas Através da Estrutura 3D  Organização estrutural  Estudos sobre o comportamento dos resíduos  Propriedades eletrostáticas dos sítios ativos de enzimas
  • 49. Informações Obtidas Através da Estrutura 3D  Informações funcionais  Estudos sobre a natureza da ligação  Localização da região de ligação  Seleção de alvos moleculares para o desenvolvimento de drogas e vacinas
  • 50. Modelagem por Homologia  A ferramenta mais bem sucedida de predição de estruturas tridimensionais de proteínas é a modelagem por homologia, também conhecida como modelagem comparativa.  As proteínas agrupam-se em um número limitado de famílias tridimensionais. Estima-se que existam cerca de 5.000 famílias protéicas.  Conseqüentemente, quando se conhece a estrutura de pelo menos um representante de uma família, é geralmente possível modelar, por homologia, os demais membros da família.
  • 51. Mioglobina Em função do número de mutações envolvidas, as seqüências de aminoácidos de proteínas homólogas podem ser, idênticas, semelhantes ou dissemelhantes.
  • 52. Modelagem por Homologia  Esta abordagem baseia-se em alguns padrões gerais que têm sido observados, em nível molecular, no processo de evolução biológica:  Homologia entre seqüências de aminoácidos implica em semelhança estrutural e funcional;  Proteínas homólogas apresentam regiões internas conservadas (principalmente constituídas de elementos de estrutura secundária: -Hélice e -Folhas;  As principais diferenças estruturais entre proteínas homólogas ocorrem nas regiões externas, constituídas principalmente por alças ("loops"), que ligam os elementos de estruturas secundárias.
  • 53. Modelagem por Homologia  A modelagem de uma proteína (proteína-problema) pelo método da homologia baseia-se no conceito de evolução molecular.  Isto é, parte-se do princípio de que a semelhança entre as estruturas primárias desta proteína e de proteínas homólogas de estruturas tridimensionais conhecidas (proteínas-molde) implica em similaridade estrutural entre elas.
  • 54. MODELAGEM MOLECULAR POR HOMOLOGIA ESTRUTURAL • Geralmente, o processo de obtenção de um modelo protéico virtual através da execução da estratégia da modelagem molecular por homologia estrutural envolve quatro etapas principais.
  • 55. Identificação dos moldes Busca por proteínas Homólogas Alinhamento de sequências Alinhamento das seqüências Construção da cadeia principal das regiões conservada Construção dos modelos Modelagem das alças Validação dos Modelos Modelo primitivo Otimização e validação não sim OK? FIM
  • 56. Identificação e seleção de proteínas- molde  (a) conhece-se a família protéica a que pertence a proteína-problema;  (b) não se sabe a que família a proteína-problema pertence.  Se o grau de identidade entre as estruturas primárias das proteínas-molde e da proteína–problema for igual ou superior a cerca de  25%, quando o número de resíduos é superior a 80, existe grande probabilidade de que estas proteínas tenham estruturas tridimensionais semelhantes.
  • 57. Alinhamento das seqüências de resíduos de aminoácidos
  • 58. Construção do modelo  Modelagem das regiões estruturalmente conservadas;  Modelagem das regiões de alças (loop);  Modelagem das cadeias laterais;  Otimização do modelo gerado.
  • 59. Validação do modelo  A qualidade estereoquímica do modelo é de importância fundamental. O programa mais utilizado na avaliação dos parâmetros estereoquímicos, o PROCHECK.  O gráfico de Ramachandran é particularmente útil porque ele define os resíduos que se encontram nas regiões energicamente mais favoráveis e desfavoráveis e orienta a avaliação da qualidade de modelos teóricos ou experimentais de proteínas.
  • 61. RMSD O parâmetro mais comum que expressa a diferença entre duas estruturas protéicas é o RMSD, ou desvio médio quadrático, em posições atômicas entre as duas estruturas.
  • 64. Calpaínas  Isoformas (classificação): Isoforma Domínios EF- Tecido Doença Hand Calpaína 1 e 2 + Ubíquas AVE, IAM (µ,m) Calpaína 3 + Músculo- Distrofia muscular esquelético Calpaína 6 - Útero e placenta SOP Calpaína 9 + Aparelho digestivo Câncer Calpaína 10 - Ubíqua Diabetes SILVA, 2012
  • 71. OBRIGADO  www.bioinform Alpha Helix for Linus Pauling (2004) Escultura de Julian Voss-Andreae 3 m de altura, revestida de aço. Portland, EUA Fonte: http://en.wikipedia.org
  • 72. B. Rost (2001) Protein secondary structure prediction continues to rise. Journal of Structural Biology, 134, pp. 204-218 (Columbia University).  Bystroff, C., Thorsson, V. & Baker, D. (2000). HMMSTR: a hidden Markov model for local sequence-structure correlations in proteins. J. Mol. Biol., 301, 173-190 (University of Washington)  Cuff, J. A., Clamp, M. E., Siddiqui, A. S., Finlay, M. & Barton, G. J. (1998). JPred: a consensus secondary structure prediction server. Bioinformatics, 14, 892-893 (JPred – Oxford/Cambridge)  Cuff, J. A. & Barton, G. J. (2000). Application of multiple sequence alignment profiles to improve protein secondary structure prediction. Proteins, 40, 502-511 (JPred2)  Rost, B. (1996). PHD: predicting one-dimensional protein structure by profile based neural networks. Meth. Enzymol., 266, 525-539. (PHD – Heidelberg – Germany)
  • 73. Referências  DonaldVoet; Judith G. Voet; Charlotte W. Pratt, Funadmentos de BIOQUÌMICA A vida em nível molecular 2ª ed., 2006.  Lehninger Principles of Biochemistry  Princípios de Bioquímica ( Lehninger ) - 4ª edição - LEHNINGER, ALBERT L. , COX, NELSON, KAY YARBOROUGH.  Przybylski, D. & Rost, B. (2000). PSI-BLAST for structure prediction: plug-in and win. Columbia University (PHDPsi)  Rost WWW, B. (2000). Better secondary structure prediction through more data. Columbia University, WWW document (http://cubic.bioc.columbia.edu/predictprotein) (PROF)  Altschul, S., Madden, T., Shaffer, A., Zhang, J., Zhang, Z. et al. (1997). Gapped Blast and PSI-Blast: a new generation of protein database search programs. Nucl. Acids Res., 25, 3389-3402. (PSI-BLAST – USA)  Jones, D. T. (1999). Protein secondary structure prediction based on position- specific scoring matrices. J. Mol. Biol., 292, 195-202 (PSIPRED – Warwick)