Introdução à Modelagem de        Proteínas por Homologia                                               MSc. Ronaldo Correi...
Objetivos Oferecer noções básicas sobre Proteínas; Apresentar técnicas de modelagem de Proteínas; Discutir a importânci...
Introdução                    Bioinformática                       Proteínas      Métodos                        Métodos  ...
Seres protéicos A vida está intimamente ligada às proteínas. Estas moléculas especiais realizam as mais variadas funções ...
Proteínas x Meio Ambiente Metano: 25 x maior potencial efeito estufa que CO2 As arqueias metanogênicas são responsáveis ...
Proteínas x Meio Ambiente                            LIMA, 2012
LuciferaseHemoglobinaQueratina
Aminoácido Um aminoácido consiste em um caborno “central” com uma ligação a grupo amino (-NH2), outra a um grupo carboxil...
Asparagina   Ácido AsparticoTirosina       Fenilalanina
Aminoácidos Single- & three-letter amino acid codes   G Glycine       Gly         P   Proline      Pro   A  Alanine    ...
Classificação dos aminoácidos Os aminoácidos podem ser classificados de acordo com o grupo R como:  Alifáticos (não pola...
Sem O2para fazerligações.
O2 presente(possui pólos)para fazer ligaçõescom carbono ehidrogênio.
Ligação Peptídica Os peptídeos são biomoléculas formadas pela ligação de dois ou mais aminoácidos através de ligações do ...
Vasopressina (ADH)oxitocina ou ocitocina.       9 aminoácidos9 aminoácidos                Insulina                Glucagon...
Conformação do Esqueleto
Interações não covalentes  Ligação de HidrogênioPonte de Hformada entre duasmoléculas de água
Eletronegatividade
Low Barrier Hydrogen Bond(LBHB) Ligação de Hidrogênio
Interações de van der Waals
Interação Hidrofóbica          Gotas de óleo na água
Ponte de Dissulfeto                      Grupo                      sulfidril
Resíduo        %  Cysteine      17.5    Serine      11.7Glutamic acid   11.1 Threonine      6.9   Glycine      6.5   Leuci...
 Covalent Bond ~ 50 - 100kcal/mol Ionic Bond ~ 5 - 80kcal/mol Hydrogen Bond ~ 3 - 6kcal/mol Hydrophobic Interaction ~ ...
Proteínas Definição: são macromoléculas complexas, compostas de aminoácidos, e necessárias para os processos químicos que...
Estrutura Primária    amino terminal ou "N-terminal" (NH3+)    carboxi terminal ("C-terminal") (COO-)
FASTA >2ANL:A|PDBID|CHAIN|SEQUENCE SENDVIELDDVANLMFYGEGEVGDNHQKFMLIFDTGSANLWVPS KCNSIGCSTKHLYDSSKSKSYEKDGTKVEITYGSGVRGFFSK...
Estrutura Secundária A estrutura secundária é uma função dos ângulos formados pelas ligações peptídicas que ligam os amin...
-Hélice           É a forma mais comum de estrutura            secundária regular;           Caracteriza-se por uma héli...
-Folhas           Envolve    2 ou mais segmentos            polipeptídicos da mesma molécula ou            de moléculas d...
Qual seria Beta Folha?
Estrutura Terciária A estrutura terciária relaciona-se com os loopings e dobraduras da cadeia protéica sobre ela mesma. ...
Estrutura Terciária                       -Folhas                  Loop             -Hélice                               ...
Estrutura Quaternária
Hemoglobina
Previsão de Estrutura de Proteínas                       Raios X       Cerca de 10 a 14 mil estruturas                    ...
Por que modelar proteínas? Dificuldade em se obter estruturas experimentais; Custo elevado
Por que modelar proteínas?
Informações Obtidas Através daEstrutura 3D Organização estrutural   Estudos sobre o comportamento   dos resíduos   Prop...
Informações Obtidas Através daEstrutura 3D Informações funcionais   Estudos   sobre   a   natureza     da    ligação   ...
Modelagem por Homologia A ferramenta mais bem sucedida de predição de estruturas  tridimensionais de proteínas é a modela...
MioglobinaEm função do número de mutações envolvidas, asseqüências de aminoácidos de proteínas homólogas podemser, idêntic...
Modelagem por Homologia Esta abordagem baseia-se em alguns padrões gerais que têm sido  observados, em nível molecular, n...
Modelagem por Homologia A modelagem de uma proteína (proteína-problema) pelo método da homologia baseia-se no conceito de...
MODELAGEM MOLECULAR POR  HOMOLOGIA ESTRUTURAL• Geralmente, o processo de obtenção de um modelo protéico virtual através da...
Identificação dos moldesBusca por proteínas Homólogas                                 Alinhamento de sequênciasAlinhamento...
Identificação e seleção de proteínas-   molde (a) conhece-se a família protéica a que pertence a  proteína-problema; (b)...
Alinhamento das seqüências deresíduos de aminoácidos
Construção do modelo Modelagem     das    regiões      estruturalmente conservadas; Modelagem das regiões de alças (loop...
Validação do modelo A qualidade estereoquímica do modelo é de importância fundamental. O programa mais utilizado  na    a...
Ramachandran
RMSDO parâmetro mais comum que expressa adiferença entre duas estruturas protéicas é oRMSD, ou desvio médio quadrático, em...
Calpaínas   Isoformas (classificação):    Isoforma     Domínios EF-         Tecido              Doença                   ...
SILVA, 2012
SILVA, 2012
SILVA, 2012
SILVA, 2012
SILVA, 2012
SILVA, 2012
OBRIGADO www.bioinform                  Alpha Helix for Linus Pauling (2004)                    Escultura de Julian Voss-...
   B. Rost (2001) Protein secondary structure prediction continues to rise. Journal of    Structural Biology, 134, pp. 20...
Referências DonaldVoet; Judith G. Voet; Charlotte W. Pratt, Funadmentos de  BIOQUÌMICA A vida em nível molecular 2ª ed., ...
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia
Aula teorica minicurso modelagem de proteinas por homologia
Próximos SlideShares
Carregando em…5
×

Aula teorica minicurso modelagem de proteinas por homologia

4.496 visualizações

Publicada em

Publicada em: Educação
0 comentários
1 gostou
Estatísticas
Notas
  • Seja o primeiro a comentar

Sem downloads
Visualizações
Visualizações totais
4.496
No SlideShare
0
A partir de incorporações
0
Número de incorporações
589
Ações
Compartilhamentos
0
Downloads
128
Comentários
0
Gostaram
1
Incorporações 0
Nenhuma incorporação

Nenhuma nota no slide

Aula teorica minicurso modelagem de proteinas por homologia

  1. 1. Introdução à Modelagem de Proteínas por Homologia MSc. Ronaldo Correia Genética e Biologia Molecular - BioinformáticaLaboratório de Planejamento e Desenvolvimento de Fármacos – LPDF - UFPa Belém-PA Novembro de 2012
  2. 2. Objetivos Oferecer noções básicas sobre Proteínas; Apresentar técnicas de modelagem de Proteínas; Discutir a importância dessas técnicas para o proteoma e planejamento de fármacos.
  3. 3. Introdução Bioinformática Proteínas Métodos Métodos experimentais Teóricos
  4. 4. Seres protéicos A vida está intimamente ligada às proteínas. Estas moléculas especiais realizam as mais variadas funções no nosso organismo tais como:  Transporte de nutrientes e metabólitos, catálise de reações biológicas;  Apesar da complexidade de suas funções, as proteínas são relativamente simples;  Repetições de 20 unidades básicas, os aminoácidos.
  5. 5. Proteínas x Meio Ambiente Metano: 25 x maior potencial efeito estufa que CO2 As arqueias metanogênicas são responsáveis por 74% do metano liberado em nossa atmosfera. Metil coenzima redutase (MCR): catálise da metanogênese. LIMA, 2012
  6. 6. Proteínas x Meio Ambiente LIMA, 2012
  7. 7. LuciferaseHemoglobinaQueratina
  8. 8. Aminoácido Um aminoácido consiste em um caborno “central” com uma ligação a grupo amino (-NH2), outra a um grupo carboxila (-COOH), a terceira a um átomo de hidrogênio e a quarta a uma cadeia lateral variável Carbono α
  9. 9. Asparagina Ácido AsparticoTirosina Fenilalanina
  10. 10. Aminoácidos Single- & three-letter amino acid codes  G Glycine Gly P Proline Pro  A Alanine Ala V Valine Val  L Leucine Leu I Isoleucine Ile  M Methionine Met C Cysteine Cys  F Phenylalanine Phe Y Tyrosine Tyr  W Tryptophan Trp H Histidine His  K Lysine Lys R Arginine Arg  Q Glutamine Gln N Asparagine Asn  E Glutamic Acid Glu D Aspartic Acid Asp  S Serine Ser T Threonine Thr
  11. 11. Classificação dos aminoácidos Os aminoácidos podem ser classificados de acordo com o grupo R como:  Alifáticos (não polares) – sem polos,sem carga;  Não carregados, polares – mas com eminência;  Carregados positivamente;  Carregados Negativamente.
  12. 12. Sem O2para fazerligações.
  13. 13. O2 presente(possui pólos)para fazer ligaçõescom carbono ehidrogênio.
  14. 14. Ligação Peptídica Os peptídeos são biomoléculas formadas pela ligação de dois ou mais aminoácidos através de ligações do tipo amida. Os peptídeos são resultantes do processamento de proteínas e podem variar de 2 ou mais aminoácidos. 2 aminoácidos: Dipeptídeo 3 aminoácidos: Tripeptídeo 4 a 10 aminoácidos: Oligopeptídeo 10 a 100 aminoácidos: Polipeptídeo mais de 100 aminoácidos: Proteína
  15. 15. Vasopressina (ADH)oxitocina ou ocitocina. 9 aminoácidos9 aminoácidos Insulina Glucagon 51 amino ácidos 29 amino ácidos
  16. 16. Conformação do Esqueleto
  17. 17. Interações não covalentes  Ligação de HidrogênioPonte de Hformada entre duasmoléculas de água
  18. 18. Eletronegatividade
  19. 19. Low Barrier Hydrogen Bond(LBHB) Ligação de Hidrogênio
  20. 20. Interações de van der Waals
  21. 21. Interação Hidrofóbica Gotas de óleo na água
  22. 22. Ponte de Dissulfeto Grupo sulfidril
  23. 23. Resíduo % Cysteine 17.5 Serine 11.7Glutamic acid 11.1 Threonine 6.9 Glycine 6.5 Leucine 6.1 Valine 5.9 Arginine 5.6Aspartic acid 5.0 Alanine 4.8 Proline 3.6 Isoleucine 2.7 Tyrosine 1.9Phenylalanine 1.4 Histidine 0.8
  24. 24.  Covalent Bond ~ 50 - 100kcal/mol Ionic Bond ~ 5 - 80kcal/mol Hydrogen Bond ~ 3 - 6kcal/mol Hydrophobic Interaction ~ 0.5 - 3kcal/mol (not a bond per se) Van der Waals Interaction ~ 1kcal/mol
  25. 25. Proteínas Definição: são macromoléculas complexas, compostas de aminoácidos, e necessárias para os processos químicos que ocorrem nos organismos vivos Nos animais, as proteínas correspondem a cerca de 80% do peso dos músculos desidratados, cerca de 70% da pele e 90% do sangue seco.
  26. 26. Estrutura Primária amino terminal ou "N-terminal" (NH3+) carboxi terminal ("C-terminal") (COO-)
  27. 27. FASTA >2ANL:A|PDBID|CHAIN|SEQUENCE SENDVIELDDVANLMFYGEGEVGDNHQKFMLIFDTGSANLWVPS KCNSIGCSTKHLYDSSKSKSYEKDGTKVEITYGSGVRGFFSKDLVT LGYLSLPYKFIEVTDTDDLEPLYTAAEFDGILGLGWKDLSIGSIDPI VVELKNQNKIDQALFTFYLPVHDKHSGYLTIGGIEEKFYEGELTYE KLNHDLFWQVDLDVNFGKTSMEKANVIVDSGTSTITAPTSFINKFF KDLNVIKVPFLPFYITTCNNKDMPTLEFKSANNTYTLEPEYYMEPL LDIDDTLCMLYILPVDIDKNTFILGDPFMRKYFTVFDYDKESIGFAV AKN
  28. 28. Estrutura Secundária A estrutura secundária é uma função dos ângulos formados pelas ligações peptídicas que ligam os aminoácidos A conformação espacial é mantida graças as interações intermoleculares (ligação hidrogênio) entre os hidrogênios dos grupos amino e os átomos de oxigênio dos outros amino ácidos.
  29. 29. -Hélice  É a forma mais comum de estrutura secundária regular;  Caracteriza-se por uma hélice em espiral formada por volta de 3 a 6 aminoácidos;  As cadeias laterais dos aminoácidos se distribuem para fora da hélice  A principal força de estabilização da a - Hélice é a ponte de hidrogênio.
  30. 30. -Folhas  Envolve 2 ou mais segmentos polipeptídicos da mesma molécula ou de moléculas diferentes, arranjados em paralelo ou no sentido anti- paralelo  Os segmentos em folha da proteína adquirem um aspecto de uma folha de papel dobrada em pregas.  As pontes de hidrogênio mais uma vez são a força de estabilização principal desta estrutura
  31. 31. Qual seria Beta Folha?
  32. 32. Estrutura Terciária A estrutura terciária relaciona-se com os loopings e dobraduras da cadeia protéica sobre ela mesma. É a conformação espacial da proteína, como um todo, e não de determinados segmentos particulares da cadeia protéica. A forma das proteínas está relacionada com sua estrutura terciária.
  33. 33. Estrutura Terciária -Folhas Loop -Hélice 2CBJ
  34. 34. Estrutura Quaternária
  35. 35. Hemoglobina
  36. 36. Previsão de Estrutura de Proteínas Raios X Cerca de 10 a 14 mil estruturas em repositórios públicos Experimental 102.000 mil estruturas RMN primárias Homologia Teórico Ab initio
  37. 37. Por que modelar proteínas? Dificuldade em se obter estruturas experimentais; Custo elevado
  38. 38. Por que modelar proteínas?
  39. 39. Informações Obtidas Através daEstrutura 3D Organização estrutural  Estudos sobre o comportamento dos resíduos  Propriedades eletrostáticas dos sítios ativos de enzimas
  40. 40. Informações Obtidas Através daEstrutura 3D Informações funcionais  Estudos sobre a natureza da ligação  Localização da região de ligação Seleção de alvos moleculares para o desenvolvimento de drogas e vacinas
  41. 41. Modelagem por Homologia A ferramenta mais bem sucedida de predição de estruturas tridimensionais de proteínas é a modelagem por homologia, também conhecida como modelagem comparativa. As proteínas agrupam-se em um número limitado de famílias tridimensionais. Estima-se que existam cerca de 5.000 famílias protéicas. Conseqüentemente, quando se conhece a estrutura de pelo menos um representante de uma família, é geralmente possível modelar, por homologia, os demais membros da família.
  42. 42. MioglobinaEm função do número de mutações envolvidas, asseqüências de aminoácidos de proteínas homólogas podemser, idênticas, semelhantes ou dissemelhantes.
  43. 43. Modelagem por Homologia Esta abordagem baseia-se em alguns padrões gerais que têm sido observados, em nível molecular, no processo de evolução biológica:  Homologia entre seqüências de aminoácidos implica em semelhança estrutural e funcional;  Proteínas homólogas apresentam regiões internas conservadas (principalmente constituídas de elementos de estrutura secundária: -Hélice e -Folhas;  As principais diferenças estruturais entre proteínas homólogas ocorrem nas regiões externas, constituídas principalmente por alças ("loops"), que ligam os elementos de estruturas secundárias.
  44. 44. Modelagem por Homologia A modelagem de uma proteína (proteína-problema) pelo método da homologia baseia-se no conceito de evolução molecular. Isto é, parte-se do princípio de que a semelhança entre as estruturas primárias desta proteína e de proteínas homólogas de estruturas tridimensionais conhecidas (proteínas-molde) implica em similaridade estrutural entre elas.
  45. 45. MODELAGEM MOLECULAR POR HOMOLOGIA ESTRUTURAL• Geralmente, o processo de obtenção de um modelo protéico virtual através da execução da estratégia da modelagem molecular por homologia estrutural envolve quatro etapas principais.
  46. 46. Identificação dos moldesBusca por proteínas Homólogas Alinhamento de sequênciasAlinhamento das seqüências Construção da cadeia principal das regiões conservada Construção dos modelos Modelagem das alças Validação dos Modelos Modelo primitivo Otimização e validação não sim OK? FIM
  47. 47. Identificação e seleção de proteínas- molde (a) conhece-se a família protéica a que pertence a proteína-problema; (b) não se sabe a que família a proteína-problema pertence. Se o grau de identidade entre as estruturas primárias das proteínas-molde e da proteína–problema for igual ou superior a cerca de 25%, quando o número de resíduos é superior a 80, existe grande probabilidade de que estas proteínas tenham estruturas tridimensionais semelhantes.
  48. 48. Alinhamento das seqüências deresíduos de aminoácidos
  49. 49. Construção do modelo Modelagem das regiões estruturalmente conservadas; Modelagem das regiões de alças (loop); Modelagem das cadeias laterais; Otimização do modelo gerado.
  50. 50. Validação do modelo A qualidade estereoquímica do modelo é de importância fundamental. O programa mais utilizado na avaliação dos parâmetros estereoquímicos, o PROCHECK. O gráfico de Ramachandran é particularmente útil porque ele define os resíduos que se encontram nas regiões energicamente mais favoráveis e desfavoráveis e orienta a avaliação da qualidade de modelos teóricos ou experimentais de proteínas.
  51. 51. Ramachandran
  52. 52. RMSDO parâmetro mais comum que expressa adiferença entre duas estruturas protéicas é oRMSD, ou desvio médio quadrático, emposições atômicas entre as duas estruturas.
  53. 53. Calpaínas  Isoformas (classificação): Isoforma Domínios EF- Tecido Doença HandCalpaína 1 e 2 + Ubíquas AVE, IAM(µ,m)Calpaína 3 + Músculo- Distrofia muscular esqueléticoCalpaína 6 - Útero e placenta SOPCalpaína 9 + Aparelho digestivo CâncerCalpaína 10 - Ubíqua Diabetes SILVA, 2012
  54. 54. SILVA, 2012
  55. 55. SILVA, 2012
  56. 56. SILVA, 2012
  57. 57. SILVA, 2012
  58. 58. SILVA, 2012
  59. 59. SILVA, 2012
  60. 60. OBRIGADO www.bioinform Alpha Helix for Linus Pauling (2004) Escultura de Julian Voss-Andreae 3 m de altura, revestida de aço. Portland, EUA Fonte: http://en.wikipedia.org
  61. 61.  B. Rost (2001) Protein secondary structure prediction continues to rise. Journal of Structural Biology, 134, pp. 204-218 (Columbia University). Bystroff, C., Thorsson, V. & Baker, D. (2000). HMMSTR: a hidden Markov model for local sequence-structure correlations in proteins. J. Mol. Biol., 301, 173-190 (University of Washington) Cuff, J. A., Clamp, M. E., Siddiqui, A. S., Finlay, M. & Barton, G. J. (1998). JPred: a consensus secondary structure prediction server. Bioinformatics, 14, 892-893 (JPred – Oxford/Cambridge) Cuff, J. A. & Barton, G. J. (2000). Application of multiple sequence alignment profiles to improve protein secondary structure prediction. Proteins, 40, 502-511 (JPred2) Rost, B. (1996). PHD: predicting one-dimensional protein structure by profile based neural networks. Meth. Enzymol., 266, 525-539. (PHD – Heidelberg – Germany)
  62. 62. Referências DonaldVoet; Judith G. Voet; Charlotte W. Pratt, Funadmentos de BIOQUÌMICA A vida em nível molecular 2ª ed., 2006. Lehninger Principles of Biochemistry Princípios de Bioquímica ( Lehninger ) - 4ª edição - LEHNINGER, ALBERT L. , COX, NELSON, KAY YARBOROUGH. Przybylski, D. & Rost, B. (2000). PSI-BLAST for structure prediction: plug-in and win. Columbia University (PHDPsi) Rost WWW, B. (2000). Better secondary structure prediction through more data. Columbia University, WWW document (http://cubic.bioc.columbia.edu/predictprotein) (PROF) Altschul, S., Madden, T., Shaffer, A., Zhang, J., Zhang, Z. et al. (1997). Gapped Blast and PSI-Blast: a new generation of protein database search programs. Nucl. Acids Res., 25, 3389-3402. (PSI-BLAST – USA) Jones, D. T. (1999). Protein secondary structure prediction based on position- specific scoring matrices. J. Mol. Biol., 292, 195-202 (PSIPRED – Warwick)

×