O slideshow foi denunciado.
Utilizamos seu perfil e dados de atividades no LinkedIn para personalizar e exibir anúncios mais relevantes. Altere suas preferências de anúncios quando desejar.
APLIKASI TEORI BEHAVIORISTIK DALAM PROSES BELAJAR MENGAJAR
A. Pendahuluan
Menurut teori behavioristik, belajar adalah peru...
Teori behavioristik sering kali tidak mampu menjelaskan situasi belajar yang kompleks,
sebab banyak variabel atau hal-hal ...
Hukum ini berpendapat, bilamana terjadi hubungan antara stimulus dan respon, dan dibarengi
oleh “State of Affairs” yang me...
bahan yang dipelajari dengan suatu bentuk akhir. Prosedur ini berbeda dengan “reception
learning” atau “expository teachin...
Faktor lain yang dianggap penting oleh aliran behavioristik adalah faktor penguatan
(reinforcement). Bila penguatan ditamb...
yang dilakukan mengubah situasi stimulus sedangkan tidak ada respon lain yang dapat
terjadi. Penguatan sekedar hanya melin...
tugas sangat berbeda tingkat kesulitannya. Pandangan behavioristik hanya mengakui adanya
stimulus dan respon yang dapat di...
Aplikasi teori behavioristik dalam kegiatan pembelajaran tergantung dari beberapa hal
seperti: tujuan pembelajaran, sifat ...
http://fuadmje.wordpress.com/2011/11/05/aplikasi-teori-behavioristik-dalam-proses-belajar-
mengajar/
Jika menelaah literat...
 Law of operant conditining yaitu jika timbulnya perilaku diiringi dengan stimulus penguat,
maka kekuatan perilaku terseb...
dari lingkungan.
Implikasi teori perkembangan kognitif Piaget dalam pembelajaran adalah :
1. Bahasa dan cara berfikiranakb...
Terdapat empat asumsi yang mendasari pandangan Gestalt, yaitu:
1. Perilaku “Molar“ hendaknya banyak dipelajari dibandingka...
(http://akhmadsudrajat.wordpress.com)
TEORI-TEORIBELAJAR DAN PENERAPANNYA
DALAM PEMBELAJARAN IPS
1. A. Teori belajarbehavioristikdan Penerapannya dalam Pembelaj...
ketikabelajar,yangdapatpulaberupapikiran,perasaan,ataugerakan/tindakan.Jadi perubahan
tingkahlakuakibatkegiatanbelajardapa...
Saran utama dari teori ini adalahguru harusdapat mengasosiasi stimulusresponsecaratepat.
Pebelajarharusdibimbingmelakukana...
responyangdapat diamati.Merekatidakmemperhatikanadanyapengaruhpikiranatauperasaan
yang mempertemukanunsur-unsuryangdiamati...
dalampenambahanpengetahuandikategorikansebagai kesalahanyangperludihukumdan
keberhasilanbelajarataukemampuandikategorikans...
 Pengetahuan Deklaratif, yaitupengetahuanyangbisadideklarasikanbiasanyadalambentuk
kata atau singkatnyapengetahuankonsept...
yang meliputitigamacamsistempenyimpananingatan:memori sensori, memori kerjadanmemori
jangkapanjang.
1. Memori Sensoriadala...
(1) suatuusaha yangpositif untukberkembang
(2) kekuatanuntukmelawanataumenolakperkembanganitu.
Maslowmengemukakanbahwaindi...
Tahun 1957, Rogerspindahke UniversitasWisconsinuntukmengembangkanidenyatentang
psikiatri.Setelahmendapatgelardoktor,Rogers...
Asumsi dasarteori Rogersadalah:
- Kecenderunganformatif
Segalahal di duniabaikorganik maupunnon-organiktersusundari hal-ha...
Oranisme menganggapduniaseperti yangdialamidandiamatinya.Realitaadalahpersepsiyang
sifatnyasubyektif dandapatmembentukting...
Terjadinyakesenjanganantarakonsepdiri dandiri ideal akanmenyebabkanketidak-seimbangandan
kepribadianmenjadi tidaksehat.
Me...
- Penghargaanpositif (positive regard)
Begitukesadaranmuncul,kebutuhanuntukdicintai,disukai,atauditerimaolehoranglain.
- P...
menerusdanakhirnyakonsepdirinyamenjadihancur.Perilakutidakterkendali ini dapatmuncul
mendadakataudapat pulamuncul bertahap...
Kecenderunganuntukhidupsepenuhnyadanseberisi mungkinpadaseiapeksistensi.Disini orang
menjadi fleksibel,adaptable,toleran,d...
2. Asumsi dasarteori Rogersadalahkecenderunganformatif dankecenderunganaktualisasi.
3. Diri (self) adalah terbentukdari pe...
Menghargai pendapat,perasaan,dansebagainyamembuattimbulnyapenerimaanakansatudengan
lainnya.Denganadanyapenerimaantersebut,...
a. Manusiaitumempunyai kemampuanbelajarsecaraalami.
b. Belajaryang signifikanterjadi apabilamateri pelajarandirasakanmurid...
Salahsatu model pendidikanterbukamencakupkonsepmengajarguruyangfasilitatifyang
dikembangkanRogersditeliti olehAspydanRoebu...
2. Fasilitatormembantuuntukmemperolehdanmemperjelastujuan-tujuanperorangandi dalam
kelasdanjuga tujuan-tujuankelompokyangb...
Aplikasi teori humanistiklebihmenunjukpadaruhatau spiritselamaprosespembelajaranyang
mewarnai metode-metodeyangditerapkan....
Ciri-ciri guruyangbaikdan kurangbaikmenurutHumanistik
Guru yang baikmenurutteori ini adalah:Guru yang memiliki rasahumor,a...
A. Teori BelajarSibernetikdanPenerapannyadalamPembelajaranIPS
Teori belajarsibernetikmerupakanteori belajar yangrelatif ba...
WorkingMemory(WM) diasumsikanmampumenangkapinformasi yangdiberi perhatianoleh
individu.KarakteristikWMadalahmemiliki kapas...
a. Landa
Landa merupakansalahseorangahli Psikologi yangberaliranSibernetik.MenurutLanda,adadua
macam prosesberpikir.Pertam...
PenerapanTeori BelajarSibernetikDalamPembelajaranIPS
Teori belajarpemrosesaninformasimendeskripsikantindakanbelajarmerupak...
Menentukanmetode pelajaran.
Mengkaji sisteminformasiyangterkandungdalammateri tersebut.
Menentukanpendekatanbelajaryangses...
C. PenerapanTeori BelajarMental dalamPembelajaranIlmuPengetahuanSosial
Teori belajardisiplinmentalmenjadi dasaruntukdisusu...
Standar kompetesibahankajianPengetahuanSosial danIlmu-IlmuSosial danKewarganegaraan
(Arnie Fajar,2009: 105), adalah:
1. Ke...
d. Terampil dalampraktikusahaekonomi sendiri.
4. Kemampuanmemahami fakta,konsep,dangeneralisasi tentang waktu,keberlanjuta...
1. PembelajaranEkonomi
Guru memberikanmateri pembelajarantentangsistemperilakuekonomi dankesejahteraandengan
memberikanpen...
Hal yangesensial padabahanpengajaranharusdijelaskankepadasiswa(Dimyati danMudjiono,
2006: 172).
Referensi
http://makalahmu...
Próximos SlideShares
Carregando em…5
×

de

Aplikasi teori behavioristik_dalam_prose Slide 1 Aplikasi teori behavioristik_dalam_prose Slide 2 Aplikasi teori behavioristik_dalam_prose Slide 3 Aplikasi teori behavioristik_dalam_prose Slide 4 Aplikasi teori behavioristik_dalam_prose Slide 5 Aplikasi teori behavioristik_dalam_prose Slide 6 Aplikasi teori behavioristik_dalam_prose Slide 7 Aplikasi teori behavioristik_dalam_prose Slide 8 Aplikasi teori behavioristik_dalam_prose Slide 9 Aplikasi teori behavioristik_dalam_prose Slide 10 Aplikasi teori behavioristik_dalam_prose Slide 11 Aplikasi teori behavioristik_dalam_prose Slide 12 Aplikasi teori behavioristik_dalam_prose Slide 13 Aplikasi teori behavioristik_dalam_prose Slide 14 Aplikasi teori behavioristik_dalam_prose Slide 15 Aplikasi teori behavioristik_dalam_prose Slide 16 Aplikasi teori behavioristik_dalam_prose Slide 17 Aplikasi teori behavioristik_dalam_prose Slide 18 Aplikasi teori behavioristik_dalam_prose Slide 19 Aplikasi teori behavioristik_dalam_prose Slide 20 Aplikasi teori behavioristik_dalam_prose Slide 21 Aplikasi teori behavioristik_dalam_prose Slide 22 Aplikasi teori behavioristik_dalam_prose Slide 23 Aplikasi teori behavioristik_dalam_prose Slide 24 Aplikasi teori behavioristik_dalam_prose Slide 25 Aplikasi teori behavioristik_dalam_prose Slide 26 Aplikasi teori behavioristik_dalam_prose Slide 27 Aplikasi teori behavioristik_dalam_prose Slide 28 Aplikasi teori behavioristik_dalam_prose Slide 29 Aplikasi teori behavioristik_dalam_prose Slide 30 Aplikasi teori behavioristik_dalam_prose Slide 31 Aplikasi teori behavioristik_dalam_prose Slide 32 Aplikasi teori behavioristik_dalam_prose Slide 33 Aplikasi teori behavioristik_dalam_prose Slide 34 Aplikasi teori behavioristik_dalam_prose Slide 35 Aplikasi teori behavioristik_dalam_prose Slide 36 Aplikasi teori behavioristik_dalam_prose Slide 37 Aplikasi teori behavioristik_dalam_prose Slide 38 Aplikasi teori behavioristik_dalam_prose Slide 39 Aplikasi teori behavioristik_dalam_prose Slide 40 Aplikasi teori behavioristik_dalam_prose Slide 41 Aplikasi teori behavioristik_dalam_prose Slide 42 Aplikasi teori behavioristik_dalam_prose Slide 43 Aplikasi teori behavioristik_dalam_prose Slide 44 Aplikasi teori behavioristik_dalam_prose Slide 45
Próximos SlideShares
What to Upload to SlideShare
Avançar
Transfira para ler offline e ver em ecrã inteiro.

0 gostaram

Compartilhar

Baixar para ler offline

Aplikasi teori behavioristik_dalam_prose

Baixar para ler offline

TKS

Livros relacionados

Gratuito durante 30 dias do Scribd

Ver tudo
  • Seja a primeira pessoa a gostar disto

Aplikasi teori behavioristik_dalam_prose

  1. 1. APLIKASI TEORI BEHAVIORISTIK DALAM PROSES BELAJAR MENGAJAR A. Pendahuluan Menurut teori behavioristik, belajar adalah perubahan tingkah laku sebagai akibat dari adanya interaksi antara stimulus dan respon. Seseorang dianggap telah belajar sesuatu apabila ia mampu menunjukkan perubahan tingkah laku. Dengan kata lain, belajar merupakan bentuk perubahan yang dialami siswa dalam hal kemampuannya untuk bertingkah laku dengan cara yang baru sebagai hasil interaksi antara stimulus dan respon. Menurut teori ini yang terpenting adalah masuk atau input yang berupa stimulus dan keluaran atau output yang berupa respon. Sedangkan apa yang terjadi di antara stimulus dan respon dianggap tidak penting diperhatikan karena tidak bisa diamati. Faktor lain yang juga dianggap penting oleh aliran behavioristik adalah faktor penguatan (reinforcement) penguatan adalah apa saja yang dapat memperkuat timbulnya respon. Bila penguatan ditambahkan (positive reinforcement) maka respon akan semakin kuat. Begitu juga bila penguatan dikurangi (negative reinforcement) respon pun akan tetap dikuatkan. B. Pembahasan 1. Teori-Teori Belajar Teori Koneksionisme Thorndike Menurut Thorndike, belajar adalah proses interaksi antara stimulus dan respon. Stimulus yaitu apa saja yang dapat merangsang terjadinya kegiatan belajar seperti pikiran, perasaan, atau hal-hal lain yang dapat ditangkap melalui alat indera. Sedangkan respon yaitu ineraksi yang dimunculkan peserta didik ketika belajar, yang juga dapat berupa pikiran, perasaan, atau gerakan/tindakan. Dari defenisi ini maka menurut Thorndike perubahan tingkah laku akibat dari kegiatan belajar itu dapat berwujud kongkrit yaitu yang dapat diamati, atau tidak kongkrit yaitu yang tidak dapat diamati. Teori Conditioning Watson Menurut Watson, belajar adalah proses interaksi antara stimulus dan respon, namun stimulus dan respon yang dimaksud harus berbentuk tingkah laku yang dapat diamati (observabel) dan dapat diukur. Dengan kata lain, walaupun ia mengakui adanya perubahan-perubahan mental dalam diri seseorang selama proses belajar, namun ia hal-hal tersebut sebagaifaktor yang tak perlu diperhitungkan. Teori Conditioning Edwin Guthrie Dijelaskan bahwa hubungan antara stimulus dan respon cenderung hanya bersifat sementara, oleh sebab itu dalam kegiatan belajar perserta didik perlu sesering mungkin diberikanstimulus agar hubungan antara stimulus dan respon bersifat tetap. Ia juga mengemukakan, agar respon yang muncul sifatnya lebih kuat dan bahkan menetap, maka diperlukan berbagai macam stimulus yang berhubungan dengan respon tersebut. Teori Operant Conditioning Skinner Menurut Skinner, hubungan antara stimulus dan respon yang terjadi melalui interaksi dalam lingkungannya, yang kemudian akan menimbulkan perubahan tingkah laku. Teori Skinnerlah yang paling besar pengaruhnya terhadap perkembangan teori belajar behavioristik. Program- program pembelajaran seperti Teaching Machine, pembelajaran berprogram, modul dan program-program pembelajaranlain yang berpijak pada konsep hubungan stimulus-respon serta mementingkan faktor-faktor penguat (reinforcement), merupakan program-program pembelajaran yang menerapkan teori belajar yang dikemukakan oleh Skinner. Teori Systematic Behavior Clark Hull Dalam teori Hull mengatakan bahwa kebutuhan biologis dan pemuasan kebutuhan biologis adalah penting dan menempati posisi sentral dalam seluruh kegiatan manusia, sehinggastimulus dalam belajarpun hampir selalu dikaitkan dengan kebutuhan biologis, walaupun respon yang akan muncul mungkin dapat bermacam-macam bentuknya. 2. Kelemahan dan kelebihan teori belajar
  2. 2. Teori behavioristik sering kali tidak mampu menjelaskan situasi belajar yang kompleks, sebab banyak variabel atau hal-hal yang berkaitan dengan pendidikan dan atau belajar yang tidak dapat diubah menjadi sekedar hubungan stimulus dan respon. Teori ini tidak mampu menjelaskan alasan-alasan yang mengacaukan hubungan antara stimulus dan respon ini dan tidak dapat menjawab hal-hal yang menyebabkan terjadinya penyimpangan antara stimulus yang diberikan dengan responnya. Namun kelebihan dari teori ini cenderung mengarahkan siswa untuk berfikir linier, konvergen, tidak kreatif dan tidak produktif. Pandangan teori ini bahwa belajar merupakan proses pembentukan atau shapping yaitu membawa siswa menuju atau mencapai target tertentu, sehingga menjadikan peserta didik untuk tidak bebas berkreasi dan berimajinasi. 3. Aplikasi Dasar Aplikasi teori ini dalam pembelajaran, bahwa kegiatan belajar ditekankan sebagai aktivitas “mimetic” yang menuntut siswa untuk mengungkapkan kembali pengetahuan yang sudah dipelajari. Penyajian materi pelajaran mengikuti urutan dari bagian-bagian ke keseluruhan. Pembelajaran dan evaluasi menekankan pada hasil, dan evaluasi menuntut satu jawaban benar. Jawabanyang benar menunjukkan bahwa siswa telah menyelesaikan tugas belajarnya. C. Kesimpulan Berdasarkan pemaparan diatas, dapat disimpulkan bahwa belajar menurut teori Behavioristik merupakan perubahan tingkah laku sebagai akibatdari adanya interaksi antara stimulus dan respon. Sedangkan apa yang terjadi di antara stimulus dan respon dianggap tidak penting diperhatikan karena tidak bisa diamati. Faktor lain yang juga dianggap penting oleh aliran behavioristik adalah faktor penguatan (reinforcement) penguatan adalah apa saja yang dapat memperkuat timbulnya respon. A.Teori-teori belajar psikologi behavioristik Psikologi aliran behavioristik mulai mengalami pengembangan dengan lahirnya teori-teori tentang belajar dipelopori oleh Thorndike, Pavlov, Watson, dan Gunthrie. Mereka berpendapat bahwa tingkah laku manusia itu dikendalikakan oleh ganjaran (rewards) atau penguatan (reinforcment)dari lingkungan. Dengan demikian dalam tingkah laku belajar terdapat jalinan yang sangat erat antara reaksi-reaksi behavioral dengan stimulasintya. Para guru sekolah yang menganut pandangan ini berpendapat bahwa tingkah laku murid- murid merupakan reaksi-reaksi terhadap lingkungan mereka pada masa lalu dan masa sekarang, dan bahwa semua tingkah laku adalah hasil belajar. Kita dapat menganalisa kejadian tingkah laku dengan jalan mempelajari latar belakang penguatan (reinforcmet) pada tingkah laku tersebut. 1.Connectism Theory Teori belajar ini dikemukakan oleh Edward Thorndrik (1874-1949) yang kemudian berpengaruh pada pendidikan dan pengajaran di Amerika Serikat. Thorndike berpendapat bahwa belajar merupakan proses pembentukan koneksi-koneksi antara stimulus dan respon. Teori ini sering pula disebut “Trial and Error learning”, individu yang belajar melakukan kegiatan melalui proses “Trial and Error” dalam rangka memilih respon yang tepat bagi stimulus tertentu. Ada beberapa hukum-hukum dalam teori “Trial and Error” menurut Thorndike dalam hasil penelitiannya, yaitu: a.Law of Readiness Hukum ini berpendapat bahwa reaksi terhadap stimulus didukung oleh kesiapan untuk bertindak atau bereaksi itu, maka reaksi menjadi memuaskan. b.Law of Exercise Hukum ini berpendapat bahwa makin banyak dipraktekan atau digunakannya hubungan stimulus atau respon, maka makin kuat hubungan itu. Praktek perlu disertai “reward” c.Law of Effect
  3. 3. Hukum ini berpendapat, bilamana terjadi hubungan antara stimulus dan respon, dan dibarengi oleh “State of Affairs” yang memuaskan, maka hubungan itu akan menjadi lebih kuat. Bilamana hubungan dibarengi “State of Affairs” yang mengganggu, maka kekuatan hubungan menjadi kurang. Ada beberapa ciri-ciri belajar dengan menggunakan “Trial and Error”, yaitu: (a) ada motif pendorong aktifitas; (b) Ada berbagai respon terhadap situasi; (c) ada eliminasi respon-respon yag gagal atau salah ; dan (d) ada kemajuan reaksi-reaksi mencapai tujuan. 2.Conditioning Theory Teori ini dikemukakan dan dikembangkan pertama kali oleh John B. Watson di AS (1878- 1958). Watson berpendapat bahwa belajar merupakan proses terjadinya refleks-refleks atau respon-respon bersyarat melalui stimulus penganti. Menurut Watson, manusia dilahirkan dengan refleks dan reaksi-reaksi emosional berupa takut, cinta, dan marah. Semua tingkah laku lainya terbentuk oleh hubungan-hubungan stimulus dan respon yang baru melalui “conditioning”. Salah satu percobaan yang terkenal adalah percobaan terhadap anak umur 11 tahun “Albert” dengan seekor tikus putih. Percobaan itu memiliki kesimpulan I bahwa rasa takut dapat timbul tanpa dipelajari dengan proses ekstinksi, dengan mengulang stimulus bersyarat tanpa dibarengi stimulus tak bersyarat. B.Teori-teori belajar Psikologi Kognitif Psikologi kognitif mulai berkembang dengan lahirnya teori belajar “Gestalt”. Peletak dasar teori ini adalah Max Wertheimer (1880-1943) di Austria yang meneliti tentang pengaamatan dan problem solving. Sumbangan ini diikuti oleh Kurt Koffka (1886-1941) yang menguraikan secara terperinci tentang hukum-hukum pengamatan; kemudian Wolfgang Kohler (1887-1959) yang meneliti tentang “insight’ pada simpanse. Kaum gestaltis berpendapat bahwa pengalaman itu berstruktur yang terbentuk dalam satu keseluuhan. Orang yang belajar, mengamati stimulus dalam keseluruhan yang terorganisir, bukan dalam bagian-bagian yang terpisah. Dalam situasi belajar, seseorang terlibat langsung dalam situasi itu dan memperoleh “Insight” untuk pemecahan masalah. Suatu konsep yang penting dalam psikologi gestalt adalah tentang “insight”, yaitu pengamatan atau pemahaman mendadak terhadap hubungan-hubungan antar bagian-bagian di dalam situasi pemasalahan. Insight juga sering dihubungkan dengan pernyataan spontan seperti “Aha!” atau “Oh, I see now” 1.Teori belajar “Cognitif-field” Teori ini dikembangkan oleh Kurt Lewin (1892-1947) dengan menaruh perhatian pada kepribadian dan psikologi sosial. Lewin memandang bahwa masing-masing individu berada di dalam suatu medan kekuatan, yang bersifat psikologis. Medan kekuatan psikologis dimana individu bereaksi disebut sebagai”Life Space”. Life Space mencakup perwujudan lingkungan dimana individu bereaksi, misalnya: orang-orang yang iya umpai, objek material yang ia hadapi, serta fungsi-fungsi kejiwaan yang ia miliki. Lewin berpendapat bahwa tingkah laku merupakan hasil tindakan antar kekuatan-kekuatan, baik yang dari dalam diri individu seperti; tujuan, kebutuhan, tekanan kejiwaan maupun dari luar diri individu, seperti; tantangan dan permasalahan. Menurut Lewin belajar berlangsung sebagai akibat dari perubahan dalam struktur kognitif yang dihasilkan dari dua macam kekuatan, satu dari strukrtur medan kognisi itu sendiri dan dari kebutuhan dan motivasi internal individu. 2.Teori belajar discovery learning Teori ini dikemukakan oleh Jerome Bruner (1993) yang ditulisnya dalam sebuah buku yang berjudul “Process of Education”. Teori ini mempunyai dasar ide bahwa anak harus berperan secara aktif dalam belajar di kelas, dimana anak atau murid harus mampu mengorganisir
  4. 4. bahan yang dipelajari dengan suatu bentuk akhir. Prosedur ini berbeda dengan “reception learning” atau “expository teaching”, dimana guru menerangkan semua bahan atau informasi itu. Di dalam buku itu Bruner melaporkan suatu hasil dari konferensi diantara para ahli Science (ilmu pengetahuan alam. Dalam hal ini ia mengemukakan pendapat bahwa mata pelajaran dapat diajarkan secara efektif dalam bentuk intelektual yang sesuai dengan tingkat perkembangan anak. Pada tingkat permulaan pengajaran hendaknya dapat diberikan melalui cara-cara yang bermakna, dan makin meningkat kea rah yang abstrak. Salah satu cara program pengajaran yang efektif menurut Bruner, ialah dengan mengkoordinasikan mode penyajian bahan dengan cara dimana anak itu dapat mempelajari bahan itu, yang sesuai dengan tingkat kemajuan anak. Tingkat-tingkat kemajuan anak dimulai dari tingkat representasi sensory (enactive) ke representasi concrit (iconic) dan akhirnya ke tingkat representasi yang abstrak (simbolik). Demikian juga dalam penyusunan kurikulum dari satu mata pelajaran, harus ditentukan oleh pengertian yang sangat fundamental bahwa hal itu dapat dicapai berdasarkan prinsip-prinsip yang memberikan struktur bagi mata pelajaran itu. Maka dalam mengajar, murid harus mempelajari prinsip-prinsip itu sehingga terbentuklah suatu disiplin dalam diri mereka. Sebalaiknya, seorang guru juga harus mampu memberian kesempatan kepada muridnya untuk menjadi seorang problem solving, seorang scientis, historin ataupun ahli matematika. Biarlah murid-murid tersebut mencari dan menemukan arti bagi diri mereka sendiri sehingga pada akhirnya memungkinkan mereka utuk mempelajari konsep-konsep di dalam bahasa yang mudah di mengerti oleh mereka. C.Perbedaan Antara teori belajar Behaviouristik dengan teori belajar Kognitif (Gestalt) Dari beberapa penjelasan teori belajar di atas, baik dari aliran behaviouristik maupun dari aliran kognitif (gestalt), dapat kita tarik suatu perbedaan yang mendasar, yaitu dimana para ahli psikologi behaviouristik lebih menitikberatkan proses hubungan “Stimulus-respon- reinforcment” sebagai bagian terpenting dalam belajar. Pendapat tersebut di tentang oleh para ahli psikologi kognitif, menurut mereka tingkah laku atau belajar seseorang senantiasa didasari pada kondisi kognisi, yaitu tindakan mengenal atau memikirkan situasi dimana tingah laku itu terjadi. Jadi mereka berpandangan bahwa tingkah lakuseseorang bergantung pada “Insight” daripada “Trial and error” terhadap hubungan-hubungan yang ada di dalam suatu situasi. Orang yang belajar, menurut ahli kognitf lebih mengamati stimuli dalam keseluruhan yang terorganisir, bukan dalam bagian-bagian yag terpisah. TEORI BELAJAR BEHAVIORISTIK DAN PENERAPANNYA DALAM PEMBELAJARAN A. Pengertian Belajar Menurut Pandangan Teori Behavioristik Menurut teori behavioristik belajar adalah perubahan tingkah laku sebagai hasil dari pengalaman (Gage, Berliner, 1984) Belajar merupakan akibat adanya interaksi antara stimulus dan respon (Slavin, 2000). Seseorang dianggap telah belajar sesuatu jika dia dapat menunjukkan perubahan perilakunya. Menurut teori ini dalam belajar yang penting adalah input yang berupa stimulus dan output yang berupa respon. Stimulus adalah apa saja yang diberikan guru kepada siswa, sedangkan respon berupa reaksi atau tanggapan siswa terhadap stimulus yang diberikan oleh guru tersebut. Proses yang terjadi antara stimulus dan respon tidak penting untuk diperhatikan karena tidak dapat diamati dan tidak dapat diukur. Yang dapat diamati adalah stimulus dan respon, oleh karena itu apa yang diberikan oleh guru (stimulus) dan apa yang diterima oleh siswa (respon) harus dapat diamati dan diukur. Teori ini mengutamakan pengukuran, sebab pengukuran merupakan suatu hal penting untuk melihat terjadi atau tidaknya perubahan tingkah laku tersebut.
  5. 5. Faktor lain yang dianggap penting oleh aliran behavioristik adalah faktor penguatan (reinforcement). Bila penguatan ditambahkan (positive reinforcement) maka respon akan semakin kuat. Begitu pula bila respon dikurangi/dihilangkan (negative reinforcement) maka responpun akan semakin kuat. Beberapa prinsip dalam teori belajar behavioristik, meliputi: (1) Reinforcement and Punishment; (2) Primary and Secondary Reinforcement;(3) Schedules of Reinforcement; (4) Contingency Management; (5) Stimulus Control in Operant Learning; (6) The Elimination of Responses (Gage, Berliner, 1984). Tokoh-tokoh aliran behavioristik di antaranya adalah Thorndike,Watson, Clark Hull, Edwin Guthrie, dan Skinner. Berikut akan dibahas karya-karya para tokoh aliran behavioristik. a.1 Teori Belajar Menurut Thorndike Menurut Thorndike, belajar adalah proses interaksi antara stimulus dan respon. Stimulus adalah apa yang merangsang terjadinya kegiatan belajar seperti pikiran, perasaan, atau hal-hal lain yang dapat ditangkap melalui alat indera. Sedangkan respon adalah reaksi yang dimunculkan peserta didik ketika belajar, yang dapat pula berupa pikiran, perasaan, atau gerakan/tindakan. Jadi perubahan tingkah laku akibat kegiatan belajar dapat berwujud konkrit, yaitu yang dapat diamati, atau tidak konkrit yaitu yang tidak dapat diamati. Meskipun aliran behaviorisme sangat mengutamakan pengukuran, tetapi tidak dapat menjelaskan bagaimana cara mengukur tingkah laku yang tidak dapat diamati. Teori Thorndike ini disebut pula dengan teori koneksionisme (Slavin, 2000). Ada tiga hukum belajar yang utama, yakni (1) hukum efek; (2) hukum latihan dan (3) hukum kesiapan (Bell, Gredler, 1991). Ketiga hukum ini menjelaskan bagaimana hal-hal tertentu dapat memperkuat respon. a.2 Teori Belajar Menurut Watson Watson mendefinisikan belajar sebagai proses interaksi antara stimulus dan respon, namun stimulus dan respon yang dimaksud harus dapat diamati (observable) dan dapat diukur. Jadi walaupun dia mengakui adanya perubahan-perubahan mental dalam diri seseorang selama proses belajar, namun dia menganggap faktor tersebut sebagai hal yang tidak perlu diperhitungkan karena tidak dapat diamati. Watson adalah seorang behavioris murni, karena kajiannya tentang belajar disejajarkan dengan ilmu-ilmu lain seperi Fisika atau Biologi yang sangat berorientasi pada pengalaman empirik semata, yaitu sejauh mana dapat diamati dan diukur. a.3 Teori Belajar Menurut Clark Hull Clark Hull juga menggunakan variabel hubungan antara stimulus dan respon untuk menjelaskan pengertian belajar. Namun dia sangat terpengaruh oleh teori evolusi Charles Darwin. Bagi Hull, seperti halnya teori evolusi, semua fungsi tingkah laku bermanfaat terutama untuk menjaga agar organisme tetap bertahan hidup. Oleh sebab itu Hull mengatakan kebutuhan biologis (drive) dan pemuasan kebutuhan biologis (drive reduction) adalah penting dan menempati posisi sentral dalam seluruh kegiatan manusia, sehingga stimulus (stimulus dorongan) dalam belajarpun hampir selalu dikaitkan dengan kebutuhan biologis, walaupun respon yang akan muncul mungkin dapat berwujud macam-macam. Penguatan tingkah laku juga masuk dalam teori ini, tetapi juga dikaitkan dengan kondisi biologis (Bell, Gredler, 1991). a.4 Teori Belajar Menurut Edwin Guthrie Azas belajar Guthrie yang utama adalah hukum kontiguiti. Yaitu gabungan stimulus-stimulus yang disertai suatu gerakan, pada waktu timbul kembali cenderung akan diikuti oleh gerakan yang sama (Bell, Gredler, 1991). Guthrie juga menggunakan variabel hubungan stimulus dan respon untuk menjelaskan terjadinya proses belajar. Belajar terjadi karena gerakan terakhir
  6. 6. yang dilakukan mengubah situasi stimulus sedangkan tidak ada respon lain yang dapat terjadi. Penguatan sekedar hanya melindungi hasil belajar yang baru agar tidak hilang dengan jalan mencegah perolehan respon yang baru. Hubungan antara stimulus dan respon bersifat sementara, oleh karena dalam kegiatan belajar peserta didik perlu sesering mungkin diberi stimulus agar hubungan stimulus dan respon bersifat lebih kuat dan menetap. Guthrie juga percaya bahwa hukuman (punishment) memegang peranan penting dalam proses belajar. Hukuman yang diberikan pada saat yang tepat akan mampu mengubah tingkah laku seseorang. Saran utama dari teori ini adalah guru harus dapat mengasosiasi stimulus respon secara tepat. Siswa harus dibimbing melakukan apa yang harus dipelajari. Dalam mengelola kelas guru tidak boleh memberikan tugas yang mungkin diabaikan oleh anak (Bell, Gredler, 1991). a.5 Tori Belajar Menurut Skinner Konsep-konsep yang dikemukanan Skinner tentang belajar lebih mengungguli konsep para tokoh sebelumnya. Ia mampu menjelaskan konsep belajar secara sederhana, namun lebih komprehensif. Menurut Skinner hubungan antara stimulus dan respon yang terjadi melalui interaksi dengan lingkungannya, yang kemudian menimbulkan perubahan tingkah laku, tidaklah sesederhana yang dikemukakan oleh tokoh tokoh sebelumnya. Menurutnya respon yang diterima seseorang tidak sesederhana itu, karena stimulus-stimulus yang diberikan akan saling berinteraksi dan interaksi antar stimulus itu akan mempengaruhi respon yang dihasilkan. Respon yang diberikan ini memiliki konsekuensi-konsekuensi. Konsekuensi- konsekuensi inilah yang nantinya mempengaruhi munculnya perilaku (Slavin, 2000). Oleh karena itu dalam memahami tingkah laku seseorang secara benar harus memahami hubungan antara stimulus yang satu dengan lainnya, serta memahami konsep yang mungkin dimunculkan dan berbagai konsekuaensi yang mungkin timbul akibat respon tersebut. Skinner juga mengmukakan bahwa dengan menggunakan perubahan-perubahan mental sebagai alat untuk menjelaskan tingkah laku hanya akan menambah rumitnya masalah. Sebab setiap alat yang digunakan perlu penjelasan lagi, demikian seterusnya. B. Analisis Tentang Teori Behavioristik Kaum behavioris menjelaskan bahwa belajar sebagai suatu proses perubahan tingkah laku dimana reinforcement dan punishment menjadi stimulus untuk merangsang siswa dalam berperilaku. Pendidik yang masih menggunakan kerangka behavioristik biasanya merencanakan kurikulum dengan menyusun isi pengetahuan menjadi bagian-bagian kecil yang ditandai dengan suatu keterampilan tertentu. Kemudian, bagian-bagian tersebut disusun secara hirarki, dari yang sederhana sampai yang komplek (Paul, 1997) Pandangan teori behavioristik telah cukup lama dianut oleh para pendidik. Namun dari semua teori yang ada, teori Skinnerlah yang paling besar pengaruhnya terhadap perkembangan teori belajar behavioristik. Program-program pembelajaran seperti Teaching Machine, Pembelajaran berprogram, modul dan program-program pembelajaran lain yang berpijak pada konsep hubungan stimulus-respons serta mementingkan faktor-faktor penguat (reinforcement), merupakan program pembelajaran yang menerapkan teori belajar yang dikemukakan Skiner. Teori behavioristik banyak dikritik karena seringkali tidak mampu menjelaskan situasi belajar yang kompleks, sebab banyak variabel atau hal-hal yang berkaitan dengan pendidikan dan/atau belajar yang dapat diubah menjadi sekedar hubungan stimulus dan respon. Teori ini tidak mampu menjelaskan penyimpangan-penyimpangan yang terjadi dalam hubungan stimulus dan respon. Pandangan behavioristik juga kurang dapat menjelaskan adanya variasi tingkat emosi siswa, walaupun mereka memiliki pengalaman penguatan yang sama. Pandangan ini tidak dapat menjelaskan mengapa dua anak yang mempunyai kemampuan dan pengalaman penguatan yang relatif sama, ternyata perilakunya terhadap suatu pelajaran berbeda, juga dalam memilih
  7. 7. tugas sangat berbeda tingkat kesulitannya. Pandangan behavioristik hanya mengakui adanya stimulus dan respon yang dapat diamati. Mereka tidak memperhatikan adanya pengaruh pikiran atau perasaan yang mempertemukan unsur-unsur yang diamati tersebut. Teori behavioristik juga cenderung mengarahkan siswa untuk berfikir linier, konvergen, tidak kreatif dan tidak produktif. Pandangan teori ini bahwa belajar merupakan proses pembentukan atau shaping, yaitu membawa siswa menuju atau mencapai target tertentu, sehingga menjadikan peserta didik untuk tidak bebas berkreasi dan berimajinasi. Padahal banyak faktor yang berpengaruh yang mempengaruhi proses belajar. Jadi teori belajar tidak sesederhana yang dilukiskan teori behavioristik. Skinner dan tokoh-tokoh lain pendukung teori behavioristik memang tidak menganjurkan digunakannya hukuman dalam kegiatan pembelajaran. Namun apa yang mereka sebut dengan penguat negatif (negative reinforcement) cenderung membatasi siswa untuk berpikir dan berimajinasi. Menurut Guthrie hukuman memegang peranan penting dalam proses belajar. Namun ada beberapa alasan mengapa Skinner tidak sependapat dengan Guthrie, yaitu: 1) Pengaruh hukuman terhadap perubahan tingkah laku sangat bersifat sementara. 2) Dampak psikologis yang buruk mungkin akan terkondisi (menjadi bagian dari jiwa si terhukum) bila hukuman berlangsung lama. 3) Hukuman yang mendorong si terhukum untuk mencari cara lain (meskipun salah dan buruk) agar ia terbebas dari hukuman. Dengan kata lain, hukuman dapat mendorong si terhukum melakukan hal-hal lain yang kadangkala lebih buruk daripada kesalahan yang diperbuatnya. Skinner lebih percaya kepada apa yang disebut sebagai penguat negatif. Penguat negatif tidak sama dengan hukuman. Ketidaksamaannya terletak pada bila hukuman harus diberikan (sebagai stimulus) agar respon yang muncul berbeda dengan respon yang sudah ada, sedangkan penguat negatif (sebagai stimulus) harus dikurangi agar respon yang sama menjadi semakin kuat. Misalnya, seorang siswa perlu dihukum karena melakukan kesalahan. Jika siswa tersebut masih saja melakukan kesalahan, maka hukuman harus ditambahkan. Tetapi jika sesuatu tidak mengenakkan siswa (sehingga ia melakukan kesalahan) dikurangi (bukan malah ditambah) dan pengurangan ini mendorong siswa untuk memperbaiki kesalahannya, maka inilah yang disebut penguatan negatif. Lawan dari penguatan negatif adalah penguatan positif (positive reinforcement). Keduanya bertujuan untuk memperkuat respon. Namun bedanya adalah penguat positif menambah, sedangkan penguat negatif adalah mengurangi agar memperkuat respons. D. Aplikasi Teori Behavioristik dalam Kegiatan Pembelajaran Aliran psikologi belajar yang sangat besar mempengaruhi arah pengembangan teori dan praktek pendidikan dan pembelajaran hingga kini adalah aliran behavioristik. Aliran ini menekankan pada terbentuknya perilaku yang tampak sebagai hasil belajar. Teori behavioristik dengan model hubungan stimulus responnya, mendudukkan orang yang belajar sebagai individu yang pasif. Respon atau perilaku tertentu dengan menggunakan metode drill atau pembiasaan semata. Munculnya perilaku akan semakin kuat bila diberikan reinforcement dan akan menghilang bila dikenai hukuman. Istilah-istilah seperti hubungan stimulus respon, individu atau siswa pasif, perilaku sebagai hasil yang tampak, pembentukan perilaku (shaping) dengan penataan kondisi secara ketat, reinforcement dan hukuman, ini semua merupakan unsur-unsur yang sangat penting dalam teori behavioristik. Teori ini hingga sekarang masih merajai praktek pembelajaran di Indonesia. Hal ini tampak dengan jelas pada penyelenggaraan pembelajaran dari tingkat yang paling dini, seperti kelompok bermain, Taman Kanak-Kanak, Sekolah Dasar, Sekolah Menengah, bahkan sampai Perguruan Tinggi, pembentukan perilaku dengan cara drill (pembiasaan) disertai dengan reinforcement atau hukuman masih sering dilakukan.
  8. 8. Aplikasi teori behavioristik dalam kegiatan pembelajaran tergantung dari beberapa hal seperti: tujuan pembelajaran, sifat materi pelajaran, karakteristik siswa, media dan fasilitas pembelajaran yang tersedia. Pembelajaran yang dirancang dan berpijak pada teori behvioristik memandang bahwa pengetahuan adalah obyektif, pasti, tetap, tidak berubah. Pengetahuan telah terstruktur dengan rapi, sehingga belajar adalah perolehan pengetahuan, sedangkan mengajar adalah memindahkan pengetahuan (transfer of knowledge)ke orang yang belajar atau siswa. Fungsi mind atau pikiran adalah untuk menjiplak struktur pengetahuan yag sudah ada melalui proses berpikir yang dapat dianalisis dan dipilah, sehingga makna yang dihasilkan dari proses berpikir seperti ini ditentukan oleh karakteristik struktur pengetahuan tersebut. Siswa diharapkan akan memiliki pemahaman yang sama terhadap pengetahuan yang diajarkan. Artinya, apa yang dipahami oleh pengajar atau guru itulah yang harus dipahami oleh murid (Degeng, 2006). Demikian halnya dalam proses belajar mengajar, siswa dianggap sebagai objek pasif yang selalu membutuhkan motivasi dan penguatan dari pendidik. Oleh karena itu, para pendidik mengembangkan kurikulum yang terstruktur dengan menggunakan standart-standart tertentu dalam proses pembelajaran yang harus dicapai oleh para siswa. Begitu juga dalam proses evaluasi belajar siswa diukur hanya pada hal-hal yang nyata dan dapat diamati sehingga hal- hal yang bersifat unobservable kurang dijangkau dalam proses evaluasi. Implikasi dari teori behavioristik dalam proses pembelajaran dirasakan kurang memberikan ruang gerak yang bebas bagi siswa untuk berkreasi, bereksperimentasi dan mengembangkan kemampuannya sendiri. Karena sistem pembelajaran tersebut bersifat otomatis-mekanis dalam menghubungkan stimulus dan respon sehingga terkesan seperti kinerja mesin atau robot. Akibatnya siswa kurang mampu untuk berkembang sesuai dengan potensi yang ada pada diri mereka. Karena teori behavioristik memandang bahwa sebagai pengetahuan telah terstruktur rapi dan teratur, maka siswa atau orang yang belajar harus dihadapkan pada aturan-aturan yang jelas dan ditetapkan terlebih dulu secara ketat. Pembiasaan dan disiplin menjadi sangat esensial dalam belajar, sehingga pembelajaran lebih banyak dikaitkan dengan penegakan disiplin. Kegagalan atau ketidakmampuan dalam penambahan pengetahuan dikategorikan sebagai kesalahan yang perlu dihukum dan keberhasilan belajar atau kemampuan dikategorikan sebagai bentuk perilaku yang pantas diberi hadiah. Demikian juga, ketaatan pada aturan dipandang sebagai penentu keberhasilan belajar. Siswa atau peserta didik adalah objek yang berperilaku sesuai dengan aturan, sehingga kontrol belajar harus dipegang oleh sistem yang berada di luar diri siswa (Degeng, 2006). Tujuan pembelajaran menurut teori behavioristik ditekankan pada penambahan pengetahuan, sedangkan belajar sebagi aktivitas “mimetic”, yang menuntut siswa untuk mengungkapkan kembali pengetahuan yang sudah dipelajari dalam bentuk laporan, kuis, atau tes. Penyajian isi atau materi pelajaran menekankan pada ketrampian yang terisolasi atau akumulasi fakta mengikuti urutan dari bagian ke keseluruhan. Pembelajaran mengikuti urutan kurikulum secara ketat, sehingga aktivitas belajar lebih banyak didasarkan pada buku teks/buku wajib dengan penekanan pada ketrampilan mengungkapkan kembali isi buku teks/buku wajib tersebut. Pembelajaran dan evaluasi menekankan pada hasil belajar. Evaluasi menekankan pada respon pasif, ketrampilan secara terpisah, dan biasanya menggunakan paper and pencil test. Evaluasi hasil belajar menuntut jawaban yang benar. Maksudnya bila siswa menjawab secara “benar” sesuai dengan keinginan guru, hal ini menunjukkan bahwa siswa telah menyelesaikan tugas belajarnya. Evaluasi belajar dipandang sebagi bagian yang terpisah dari kegiatan pembelajaran, dan biasanya dilakukan setelah selesai kegiatan pembelajaran. Teori ini menekankan evaluasi pada kemampuan siswa secara individual (Degeng, 2006).
  9. 9. http://fuadmje.wordpress.com/2011/11/05/aplikasi-teori-behavioristik-dalam-proses-belajar- mengajar/ Jika menelaah literatur psikologi, kita akan menemukan banyak teori belajar yang bersumber dari aliran-aliranpsikologi.Dalamtautandi bawahini akandikemukakanempatjenisteori belajar, yaitu: (A) teori behaviorisme;(B) teori belajarkognitif menurutPiaget;(C) teori pemrosesan informasi dari Gagne, dan (D) teori belajar gestalt. A.Teori Behaviorisme Behaviorismemerupakansalahaliranpsikologi yangmemandangindividu hanya dari sisi fenomena jasmaniah,danmengabaikanaspek –aspekmental.Dengankatalain,behaviorisme tidak mengakui adanya kecerdasan, bakat, minat dan perasaan individu dalam suatu belajar. Peristiwa belajar semata-mata melatih refleks-refleks sedemikian rupa sehingga menjadi kebiasaan yang dikuasai individu. Beberapa hukum belajar yang dihasilkan dari pendekatan behaviorisme ini, diantaranya : 1.Connectionism ( S-R Bond) menurut Thorndike. Dari eksperimen yang dilakukan Thorndike terhadap kucing menghasilkan hukum-hukum belajar, diantaranya: Law of Effect; artinya bahwa jika sebuah respons menghasilkan efek yang memuaskan, maka hubunganStimulus –Responsakansemakinkuat.Sebaliknya, semakin tidak memuaskan efek yang dicapai respons, maka semakin lemah pula hubungan yang terjadi antara Stimulus- Respons.  Law of Readiness; artinya bahwa kesiapan mengacu pada asumsi bahwa kepuasan organisme itu berasal dari pemdayagunaan satuan pengantar (conduction unit), dimana unit-unitini menimbulkan kecenderungan yang mendorong organisme untuk berbuat atau tidak berbuat sesuatu.  Law of Exercise; artinya bahwa hubungan antara Stimulus dengan Respons akan semakin bertambah erat, jika sering dilatih dan akan semakin berkurang apabila jarang atau tidak dilatih. 2.Classical Conditioning menurut Ivan Pavlov Dari eksperimenyangdilakukanPavlovterhadapseekoranjingmenghasilkanhukum-hukumbelajar, diantaranya :  Law of Respondent Conditioning yakni hukum pembiasaan yang dituntut. Jika dua macam stimulusdihadirkansecarasimultan(yangsalahsatunyaberfungsi sebagai reinforcer), maka refleks dan stimulus lainnya akan meningkat.  Law of Respondent Extinction yakni hukum pemusnahan yang dituntut. Jika refleks yang sudah diperkuat melalui Respondent conditioning itu didatangkan kembali tanpa menghadirkan reinforcer, maka kekuatannya akan menurun. 3.Operant Conditioning menurut B.F. Skinner Dari eksperimen yang dilakukan B.F. Skinner terhadap tikus dan selanjutnya terhadap burung merpati menghasilkan hukum-hukum belajar, diantaranya :
  10. 10.  Law of operant conditining yaitu jika timbulnya perilaku diiringi dengan stimulus penguat, maka kekuatan perilaku tersebut akan meningkat.  Law of operant extinction yaitu jika timbulnya perilaku operant telah diperkuat melalui proses conditioning itu tidak diiringi stimulus penguat, maka kekuatan perilaku tersebut akan menurun bahkan musnah. Reber (Muhibin Syah, 2003) menyebutkan bahwa yang dimaksud dengan operant adalah sejumlah perilakuyangmembawaefekyangsamaterhadaplingkungan.Respons dalam operant conditioning terjadi tanpa didahului oleh stimulus, melainkan oleh efek yang ditimbulkan oleh reinforcer. Reinforcer itu sendiri pada dasarnya adalah stimulus yang meningkatkan kemungkinan timbulnya sejumlahresponstertentu,namuntidaksengajadiadakansebagaipasanganstimuluslainnyaseperti dalam classical conditioning. 4.Social Learning menurut Albert Bandura Teori belajar sosial atau disebut juga teori observational learning adalah sebuah teori belajar yang relatif masih baru dibandingkan dengan teori-teori belajar lainnya. Berbeda dengan penganut Behaviorisme lainnya, Bandura memandang Perilaku individu tidak semata-mata refleks otomatis atas stimulus (S-R Bond), melainkan juga akibat reaksi yang timbul sebagai hasil interaksi antara lingkungandenganskemakognitifindividuitusendiri.Prinsipdasarbelajarmenurutteori ini, bahwa yang dipelajariindividuterutamadalambelajarsosial danmoral terjadi melalui peniruan (imitation) dan penyajiancontohperilaku(modeling).Teori ini jugamasihmemandangpentingnya conditioning. Melalui pemberian reward danpunishment, seorangindividuakanberfikirdanmemutuskanperilaku sosial mana yang perlu dilakukan. Sebetulnya masih banyak tokoh-tokoh lain yang mengembangkan teori belajar behavioristik ini, seperti : Watson yang menghasilkan prinsip kekerapan dan prinsip kebaruan, Guthrie dengan teorinyayangdisebut Contiguity Theory yangmenghasilkanMetode Ambang(the treshold method), metode meletihkan (The Fatigue Method) dan Metode rangsangan tak serasi (The Incompatible Response Method), Miller dan Dollard dengan teori pengurangan dorongan. B.Teori Belajar Kognitif menurut Piaget Piagetmerupakansalahseorangtokohyang disebut-sebut sebagai pelopor aliran konstruktivisme. Salah satu sumbangan pemikirannya yang banyak digunakan sebagai rujukan untuk memahami perkembangankognitif individuyaituteoritentangtahapanperkembanganindividu.MenurutPiaget bahwa perkembangan kognitif individu meliputi empat tahap yaitu : (1) sensory motor; (2) pre operational;(3) concrete operational dan (4) formal operational. Pemikiran lain dari Piaget tentang proses rekonstruksi pengetahuan individu yaitu asimilasi dan akomodasi. James Atherton (2005) menyebutkanbahwaasisimilasi adalah“theprocessby which a person takes material into their mind from the environment, which may mean changing the evidence of their senses to make it fit” dan akomodasi adalah “the difference made to one’s mind or concepts by the process of assimilation” Dikemukakannya pula, bahwa belajar akan lebih berhasil apabila disesuaikan dengan tahap perkembangankognitif pesertadidik.Pesertadidikhendaknyadiberi kesempatan untuk melakukan eksperimen dengan obyek fisik, yang ditunjang oleh interaksi dengan teman sebaya dan dibantu olehpertanyaantilikandari guru.Guruhendaknyabanyak memberikan rangsangan kepada peserta didikagar mauberinteraksi dengan lingkungan secara aktif, mencari dan menemukan berbagai hal
  11. 11. dari lingkungan. Implikasi teori perkembangan kognitif Piaget dalam pembelajaran adalah : 1. Bahasa dan cara berfikiranakberbedadenganorangdewasa.Olehkarenaitugurumengajar dengan menggunakan bahasa yang sesuai dengan cara berfikir anak. 2. Anak-anakakanbelajarlebihbaikapabila dapat menghadapi lingkungan dengan baik. Guru harus membantu anak agar dapat berinteraksi dengan lingkungan sebaik-baiknya. 3. Bahan yang harus dipelajari anak hendaknya dirasakan baru tetapi tidak asing. 4. Berikan peluang agar anak belajar sesuai tahap perkembangannya. 5. Di dalam kelas, anak-anak hendaknya diberi peluang untuk saling berbicara dan diskusi dengan teman-temanya. C.Teori Pemrosesan Informasi dari Robert Gagne Asumsi yangmendasari teori ini adalahbahwapembelajaranmerupakanfaktor yang sangat penting dalam perkembangan. Perkembangan merupakan hasil kumulatif dari pembelajaran. Menurut Gagne bahwa dalam pembelajaran terjadi proses penerimaan informasi, untuk kemudian diolah sehingga menghasilkan keluaran dalam bentuk hasil belajar. Dalam pemrosesan informasi terjadi adanya interaksi antara kondisi-kondisi internal dan kondisi-kondisi eksternal individu. Kondisi internal yaitukeadaandalamdiri individuyang diperlukan untuk mencapai hasil belajar dan proses kognitif yangterjadi dalamindividu.Sedangkankondisi eksternaladalahrangsangan dari lingkungan yang mempengaruhi individu dalam proses pembelajaran. Menurut Gagne tahapan proses pembelajaran meliputi delapan fase yaitu, (1) motivasi; (2) pemahaman;(3) pemerolehan;(4) penyimpanan;(5) ingatankembali;(6) generalisasi; (7) perlakuan dan (8) umpan balik. D. Teori Belajar Gestalt Gestaltberasal dari bahasa Jermanyangmempunyai padananarti sebagai “bentukatau konfigurasi”. Pokok pandangan Gestalt adalah bahwa obyek atau peristiwa tertentu akan dipandang sebagai sesuatukeseluruhanyangterorganisasikan.MenurutKoffkadanKohler,adatujuh prinsip organisasi yang terpenting yaitu : 1. Hubunganbentukdanlatar (figureand gound relationship);yaitumenganggapbahwasetiap bidang pengamatan dapat dibagi dua yaitu figure (bentuk) dan latar belakang. Penampilan suatuobyekseperti ukuran,potongan,warnadansebagainyamembedakan figure dari latar belakang.Bilafigure danlatarbersifatsamar-samar,makaakanterjadi kekaburanpenafsiran antara latar dan figure. 2. Kedekatan (proxmity); bahwa unsur-unsur yang saling berdekatan (baik waktu maupun ruang) dalam bidang pengamatan akan dipandang sebagai satu bentuk tertentu. 3. Kesamaan (similarity); bahwa sesuatu yang memiliki kesamaan cenderung akan dipandang sebagai suatu obyek yang saling memiliki. 4. Arah bersama (common direction); bahwa unsur-unsur bidang pengamatan yang berada dalamarah yang sama cenderungakandipersepsi sebagi suatu figure atau bentuk tertentu. 5. Kesederhanaan(simplicity);bahwaorangcenderungmenatabidangpengamatannyabentuk yang sederhana, penampilan reguler dan cenderung membentuk keseluruhan yang baik berdasarkan susunan simetris dan keteraturan; dan 6. Ketertutupan(closure) bahwaorangcenderungakan mengisi kekosongan suatu pola obyek atau pengamatan yang tidak lengkap.
  12. 12. Terdapat empat asumsi yang mendasari pandangan Gestalt, yaitu: 1. Perilaku “Molar“ hendaknya banyak dipelajari dibandingkan dengan perilaku “Molecular”. Perilaku“Molecular” adalah perilaku dalam bentuk kontraksi otot atau keluarnya kelenjar, sedangkan perilaku “Molar” adalah perilaku dalam keterkaitan dengan lingkungan luar. Berlari, berjalan, mengikuti kuliah, bermain sepakbola adalah beberapa perilaku “Molar”. Perilaku “Molar” lebih mempunyai makna dibanding dengan perilaku “Molecular”. 2. Hal yang penting dalam mempelajari perilaku ialah membedakan antara lingkungan geografis dengan lingkungan behavioral. Lingkungan geografis adalah lingkungan yang sebenarnya ada, sedangkan lingkungan behavioral merujuk pada sesuatu yang nampak. Misalnya, gunung yang nampak dari jauh seolah-olah sesuatu yang indah. (lingkungan behavioral),padahal kenyataannyamerupakan suatu lingkungan yang penuh dengan hutan yang lebat (lingkungan geografis). 3. Organisme tidak mereaksi terhadap rangsangan lokal atau unsur atau suatu bagian peristiwa, akan tetapi mereaksi terhadap keseluruhan obyek atau peristiwa. Misalnya, adanya penamaan kumpulan bintang, seperti : sagitarius, virgo, pisces, gemini dan sebagainya adalah contoh dari prinsip ini. Contoh lain, gumpalan awan tampak seperti gunung atau binatang tertentu. 4. Pemberianmaknaterhadapsuaturangsangansensorisadalahmerupakansuatuprosesyang dinamis dan bukan sebagai suatu reaksi yang statis. Proses pengamatan merupakan suatu proses yang dinamis dalam memberikan tafsiran terhadap rangsangan yang diterima. Aplikasi teori Gestalt dalam proses pembelajaran antara lain : 1. Pengalamantilikan(insight);bahwatilikanmemegangperananyangpentingdalamperilaku. Dalam proses pembelajaran, hendaknya peserta didik memiliki kemampuan tilikan yaitu kemampuan mengenal keterkaitan unsur-unsur dalam suatu obyek atau peristiwa. 2. Pembelajaran yang bermakna (meaningful learning); kebermaknaan unsur-unsur yang terkait akan menunjang pembentukan tilikan dalam proses pembelajaran. Makin jelas makna hubungan suatu unsur akan makin efektif sesuatu yang dipelajari. Hal ini sangat penting dalam kegiatan pemecahan masalah, khususnya dalam identifikasi masalah dan pengembangan alternatif pemecahannya. Hal-hal yang dipelajari peserta didik hendaknya memiliki makna yang jelas dan logis dengan proses kehidupannya. 3. Perilakubertujuan(pusposivebehavior);bahwaperilakuterarahpadatujuan.Perilaku bukan hanyaterjadi akibathubunganstimulus-respons, tetapi ada keterkaitannya dengan dengan tujuan yang ingin dicapai. Proses pembelajaran akan berjalan efektif jika peserta didik mengenal tujuanyangingindicapainya.Oleh karena itu, guru hendaknya menyadari tujuan sebagai arah aktivitaspengajarandanmembantupesertadidikdalammemahami tujuannya. 4. Prinsip ruang hidup (life space); bahwa perilaku individu memiliki keterkaitan dengan lingkungan dimana ia berada. Oleh karena itu, materi yang diajarkan hendaknya memiliki keterkaitan dengan situasi dan kondisi lingkungan kehidupan peserta didik. 5. Transfer dalam Belajar; yaitu pemindahan pola-pola perilaku dalam situasi pembelajaran tertentu ke situasi lain. Menurut pandangan Gestalt, transfer belajar terjadi dengan jalan melepaskanpengertianobyekdari suatukonfigurasi dalamsituasi tertentu untuk kemudian menempatkan dalam situasi konfigurasi lain dalam tata-susunan yang tepat. Judd menekankanpentingnyapenangkapanprinsip-prinsippokok yang luas dalam pembelajaran dan kemudianmenyusunketentuan-ketentuan umum (generalisasi). Transfer belajar akan terjadi apabilapesertadidiktelahmenangkapprinsip-prinsippokokdari suatupersoalandan menemukan generalisasi untuk kemudian digunakan dalam memecahkan masalah dalam situasi lain. Oleh karena itu, guru hendaknya dapat membantu peserta didik untuk menguasai prinsip-prinsip pokok dari materi yang diajarkannya.
  13. 13. (http://akhmadsudrajat.wordpress.com)
  14. 14. TEORI-TEORIBELAJAR DAN PENERAPANNYA DALAM PEMBELAJARAN IPS 1. A. Teori belajarbehavioristikdan Penerapannya dalam PembelajaranIPS Teori belajarbehavioristikadalahsebuahteori yangdicetuskanoleh Gage danBerlinertentang perubahantingkahlakusebagai hasil dari pengalaman. Teori ini laluberkembangmenjadi aliranpsikologi belajaryangberpengaruhterhadaparah pengembanganteori danpraktekpendidikan danpembelajaran yangdikenal sebagai aliran behavioristik.Aliranini menekankanpadaterbentuknyaperilakuyangtampaksebagai hasil belajar. Teori behavioristik denganmodel hubunganstimulus-responnya,mendudukkanorangyangbelajar sebagai individuyangpasif.Responatauperilakutertentudenganmenggunakanmetode pelatihan atau pembiasaansemata.Munculnyaperilakuakansemakinkuatbiladiberikanpenguatandanakan menghilangbiladikenaihukuman. Belajarmerupakanakibatadanyainteraksi antarastimulus danrespon(Slavin,2000:143). Seseorang dianggaptelahbelajarsesuatujikadiadapatmenunjukkanperubahanperilakunya.Menurutteori ini dalambelajaryangpentingadalahinputyangberupastimulusdanoutputyangberuparespon. Stimulusadalahapasajayang diberikangurukepadapebelajar,sedangkanresponberupareaksi atau tanggapanpebelajarterhadapstimulusyangdiberikanolehgurutersebut.Prosesyangterjadi antara stimulusdanrespontidakpentinguntukdiperhatikankarenatidakdapatdiamati dantidak dapat diukur.Yangdapat diamati adalahstimulusdanrespon,olehkarenaituapayang diberikan olehguru(stimulus) danapayangditerimaolehpebelajar(respon)harusdapatdiamati dandiukur. Teori ini mengutamakanpengukuran,sebabpengukuranmerupakansuatuhal pentinguntuk melihatterjadi atautidaknyaperubahantingkahlakutersebut. Faktor lainyangdianggappentingolehaliranbehavioristikadalahfaktorpenguatan(reinforcement). Bilapenguatanditambahkan(positive reinforcement) makaresponakansemakinkuat.Begitupula bilarespondikurangi/dihilangkan(negativereinforcement) makaresponjugasemakinkuat. Beberapaprinsipdalamteori belajar behavioristik,meliputi:(1) ReinforcementandPunishment;(2) Primaryand SecondaryReinforcement;(3) Schedulesof Reinforcement;(4) Contingency Management;(5) StimulusControl inOperantLearning;(6) The Eliminationof Responses(Gage, Berliner,1984). Tokoh-tokohaliranbehavioristikdi antaranyaadalah Thorndike,Watson,ClarkHull,EdwinGuthrie, dan Skinner.Berikutakandibahaskarya-karyaparatokohaliranbehavioristikdananalisisserta peranannyadalampembelajaran. 1. 1. Teori Belajar Menurut Thorndike MenurutThorndike,belajaradalahprosesinteraksi antarastimulusdanrespon.Stimulusadalahapa yang merangsangterjadinyakegiatanbelajarseperti pikiran,perasaan,atauhal-hal lainyangdapat ditangkapmelalui alatindera.Sedangkanresponadalahreaksi yangdimunculkanpesertadidik
  15. 15. ketikabelajar,yangdapatpulaberupapikiran,perasaan,ataugerakan/tindakan.Jadi perubahan tingkahlakuakibatkegiatanbelajardapatberwujudkonkrit,yaituyangdapatdiamati,atautidak konkrityaituyangtidakdapat diamati.Meskipunaliranbehaviorisme sangatmengutamakan pengukuran,tetapi tidakdapatmenjelaskanbagaimanacaramengukurtingkahlakuyangtidak dapat diamati.Teori Thorndike inidisebutpuladengan teori koneksionisme (Slavin,2000). Ada tigahukumbelajaryangutama,menurutThorndike yakni (1) hukumefek;(2) hukumlatihandan (3) hukumkesiapan(Bell,Gredler,1991).Ketigahukumini menjelaskanbagaimanahal-hal tertentu dapat memperkuatrespon. 1. 2. Teori Belajar Menurut Watson Watson mendefinisikanbelajarsebagai prosesinteraksi antarastimulusdanrespon,namunstimulus dan responyangdimaksudharusdapatdiamati (observable) dandapatdiukur.Jadi walaupundia mengakui adanyaperubahan-perubahanmentaldalamdiri seseorangselamaprosesbelajar,namun diamenganggapfaktortersebutsebagai hal yangtidakperludiperhitungkankarenatidakdapat diamati.Watsonadalahseorangbehaviorismurni,karenakajiannyatentangbelajardisejajarkan denganilmu-ilmulainseperiFisikaatauBiologi yangsangatberorientasipadapengalamanempirik semata,yaitusejauhmanadapat diamati dandiukur. 1. 3. Teori Belajar Menurut Clark Hull ClarkHull juga menggunakanvariabelhubunganantarastimulusdanresponuntukmenjelaskan pengertianbelajar.Namundiasangatterpengaruholehteori evolusi CharlesDarwin.Bagi Hull, seperti halnyateori evolusi,semuafungsitingkahlakubermanfaatterutamauntukmenjagaagar organisme tetapbertahanhidup.OlehsebabituHull mengatakankebutuhanbiologis(drive)dan pemuasankebutuhanbiologis(drivereduction) adalahpentingdanmenempati posisi sentral dalam seluruhkegiatanmanusia,sehinggastimulus(stimulusdorongan) dalambelajarpunhampirselalu dikaitkandengankebutuhanbiologis,walaupunresponyangakanmuncul mungkindapatberwujud macam-macam.Penguatantingkahlakujugamasukdalam teori ini,tetapi jugadikaitkandengan kondisi biologis(Bell,Gredler,1991). 1. 4. Teori Belajar Menurut Edwin Guthrie AzasbelajarGuthrie yangutama adalahhukumkontiguiti.Yaitugabunganstimulus-stimulusyang disertai suatugerakan,padawaktutimbul kembali cenderungakandiikuti olehgerakanyangsama (Bell,Gredler,1991). Guthrie jugamenggunakanvariabel hubunganstimulusdanresponuntuk menjelaskanterjadinyaprosesbelajar.Belajarterjadi karenagerakanterakhiryangdilakukan mengubahsituasi stimulussedangkantidakadaresponlainyangdapatterjadi.Penguatansekedar hanyamelindungi hasil belajaryangbaruagar tidakhilangdenganjalanmencegahperolehanrespon yang baru.Hubunganantara stimulusdanresponbersifatsementara,olehkarenadalamkegiatan belajarpesertadidik perluseseringmungkindiberi stimulusagarhubunganstimulusdanrespon bersifatlebihkuatdanmenetap.Guthrie jugapercayabahwahukuman(punishment) memegang perananpentingdalamprosesbelajar.Hukumanyangdiberikanpadasaatyangtepatakan mampu mengubahtingkahlakuseseorang.
  16. 16. Saran utama dari teori ini adalahguru harusdapat mengasosiasi stimulusresponsecaratepat. Pebelajarharusdibimbingmelakukanapayangharus dipelajari.Dalammengelolakelasgurutidak bolehmemberikantugasyangmungkindiabaikanolehanak(Bell,Gredler,1991). 1. 5. Teori Belajar Menurut Skinner Konsep-konsepyangdikemukananSkinnertentangbelajar lebihmengungguli konsepparatokoh sebelumnya.Iamampumenjelaskankonsepbelajarsecarasederhana,namunlebih komprehensif. MenurutSkinnerhubunganantarastimulusdanresponyangterjadi melalui interaksidengan lingkungannya,yangkemudianmenimbulkanperubahantingkahlaku,tidaklahsesederhanayang dikemukakanolehtokohtokohsebelumnya.Menurutnyaresponyangditerimaseseorangtidak sesederhanaitu,karenastimulus-stimulusyangdiberikanakansalingberinteraksidaninteraksi antar stimulusituakanmempengaruhiresponyangdihasilkan.Responyangdiberikaninimemiliki konsekuensi-konsekuensi.Konsekuensi-konsekuensi inilahyangnantinyamempengaruhimunculnya perilaku(Slavin,2000).Olehkarenaitudalammemahami tingkahlakuseseorangsecarabenarharus memahami hubunganantarastimulusyangsatudenganlainnya,sertamemahamikonsepyang mungkindimunculkan danberbagai konsekuensi yangmungkintimbulakibatrespontersebut. Skinnerjugamengemukakanbahwadenganmenggunakanperubahan-perubahanmental sebagai alat untukmenjelaskantingkahlakuhanyaakanmenambahrumitnyamasalah.Sebabsetiapalat yang digunakanperlupenjelasanlagi,demikianseterusnya. AnalisisTentang Teori Behavioristik Kaumbehaviorismenjelaskanbahwabelajarsebagai suatuprosesperubahantingkahlakudimana reinforcementdanpunishmentmenjadi stimulusuntukmerangsangpebelajardalamberperilaku. Pendidikyangmasihmenggunakankerangkabehavioristikbiasanyamerencanakankurikulum denganmenyusunisi pengetahuanmenjadi bagian-bagiankecil yangditandaidengansuatu keterampilantertentu.Kemudian,bagian-bagiantersebutdisusunsecarahirarki,dari yang sederhanasampai yangkomplek(Paul,1997). Pandanganteori behavioristiktelahcukuplamadianutolehparapendidik.Namundari semuateori yang ada,teori Skinnerlahyangpalingbesarpengaruhnyaterhadapperkembanganteori belajar behavioristik.Program-programpembelajaranseperti Teaching Machine,Pembelajaranberprogram, modul danprogram-programpembelajaranlainyangberpijakpadakonsephubunganstimulus- responssertamementingkanfaktor-faktorpenguat(reinforcement),merupakanprogram pembelajaranyangmenerapkanteori belajaryangdikemukakanSkiner. Teori behavioristikbanyakdikritikkarenaseringkali tidakmampumenjelaskansituasibelajaryang kompleks,sebabbanyakvariabel atauhal-hal yangberkaitandenganpendidikandan/ataubelajar yang dapatdiubahmenjadi sekedarhubunganstimulusdanrespon.Teori ini tidakmampu menjelaskanpenyimpangan-penyimpanganyangterjadi dalamhubunganstimulusdanrespon. Pandanganbehavioristikjugakurangdapatmenjelaskanadanyavariasi tingkatemosi pebelajar, walaupunmerekamemiliki pengalamanpenguatanyangsama.Pandanganini tidakdapat menjelaskanmengapaduaanakyangmempunyai kemampuandanpengalamanpenguatanyang relatif sama,ternyataperilakunyaterhadapsuatupelajaranberbeda,jugadalammemilihtugas sangat berbedatingkatkesulitannya.Pandanganbehavioristikhanyamengakui adanyastimulusdan
  17. 17. responyangdapat diamati.Merekatidakmemperhatikanadanyapengaruhpikiranatauperasaan yang mempertemukanunsur-unsuryangdiamati tersebut. Teori behavioristikjugacenderungmengarahkanpebelajaruntukberfikirlinier,konvergen,tidak kreatif dantidakproduktif.Pandanganteori ini bahwabelajarmerupakanprosespembentukanatau shaping,yaitumembawapebelajarmenuju ataumencapai targettertentu,sehinggamenjadikan pesertadidiktidakbebasberkreasi danberimajinasi.Padahal banyakfaktoryangmempengaruhi prosesbelajar,prosesbelajartidaksekedarpembentukanatau shaping. Aplikasi Teori Behavioristikdalam PembelajaranIPS Aliranpsikologibelajaryangsangatbesarpengaruhnyaterhadaparahpengembanganteori dan praktekpendidikandanpembelajaranhinggakiniadalahaliranbehavioristik.Aliranini menekankan pada terbentuknyaperilakuyangtampaksebagai hasil belajar.Teori behavioristikdenganmodel hubunganstimulusresponnya,mendudukkanorangyangbelajarsebagai individuyangpasif.Respon atau perilakutertentudenganmenggunakanmetodedrillataupembiasaansemata.Munculnya perilakuakansemakinkuatbiladiberikanreinforcementdanakanmenghilangbiladikenai hukuman. Aplikasi teori behavioristikdalamkegiatanpembelajaran IPStergantungdari beberapahal seperti: tujuanpembelajaran,sifatmateri pelajaran,karakteristikpelajar,mediadanfasilitas pembelajaran yang tersedia.Pembelajaranyangdirancangdanberpijakpadateori behavioristikmemandang bahwapengetahuanadalahobyektif,pasti,tetap,tidakberubah.Pengetahuantelahterstruktur denganrapi,sehinggabelajaradalahperolehanpengetahuan,sedangkanmengajaradalah memindahkanpengetahuan(transferof knowledge) ke orangyangbelajarataupebelajar.Fungsi mindatau pikiranadalahuntukmenjiplakstrukturpengetahuanyagsudahadamelalui proses berpikiryangdapatdianalisisdandipilah, sehinggamaknayangdihasilkandari prosesberpikir seperti ini ditentukanolehkarakteristikstrukturpengetahuantersebut.Pebelajardiharapkanakan memilikipemahamanyangsamaterhadappengetahuanyangdiajarkan.Artinya,apayangdipahami olehpengajaratauguru itulahyangharusdipahami olehmurid. Demikianhalnyadalampembelajaran,pebelajardianggapsebagaiobjekpasifyangselalu membutuhkanmotivasi danpenguatandari pendidik.Olehkarenaitu,parapendidik mengembangkankurikulumyangterstrukturdenganmenggunakanstandar-standartertentudalam prosespembelajaranyangharusdicapai olehparapebelajar.Begitujugadalamprosesevaluasi belajarpebelajardiukurhanyapadahal-hal yangnyatadan dapatdiamati sehinggahal-hal yang bersifattidakteramati kurangdijangkaudalamprosesevaluasi. Implikasi dari teori behavioristikdalamprosespembelajarandirasakankurangmemberikanruang gerakyang bebasbagi pebelajaruntukberkreasi,bereksperimentasidanmengembangkan kemampuannyasendiri.Karenasistempembelajarantersebutbersifatotomatis-mekanisdalam menghubungkanstimulusdanresponsehinggaterkesanseperti kinerjamesinataurobot.Akibatnya pebelajarkurangmampuuntukberkembangsesuai denganpotensiyangadapada diri mereka. Karenateori behavioristikmemandangbahwapengetahuantelahterstrukturrapi danteratur,maka pebelajaratauorangyang belajarharusdihadapkanpadaaturan-aturanyangjelasdanditetapkan terlebihdulusecaraketat.Pembiasaandandisiplinmenjadi sangatesensial dalambelajar,sehingga pembelajaranlebihbanyakdikaitkandenganpenegakandisiplin.Kegagalanatauketidakmampuan
  18. 18. dalampenambahanpengetahuandikategorikansebagai kesalahanyangperludihukumdan keberhasilanbelajarataukemampuandikategorikansebagai bentukperilakuyangpantasdiberi hadiah.Demikianjuga,ketaatanpadaaturandipandangsebagai penentukeberhasilanbelajar. Pebelajarataupesertadidikadalahobjekyangberperilakusesuai denganaturan,sehinggakontrol belajarharusdipegangolehsistemyangberadadi luardiri pebelajar. Tujuanpembelajaranmenurutteori behavioristikditekankanpadapenambahanpengetahuan, sedangkanbelajarsebagi aktivitas“mimetic”,yangmenuntutpebelajaruntukmengungkapkan kembali pengetahuanyangsudahdipelajaridalambentuklaporan,kuis,atautes.Penyajianisi atau materi pelajaranmenekankanpadaketrampianyangterisolasiatauakumulasi faktamengikuti urutan dari bagianke keseluruhan.Pembelajaranmengikutiurutankurikulumsecaraketat,sehingga aktivitasbelajarlebihbanyakdidasarkanpadabukuteks/bukuwajibdenganpenekananpada ketrampilanmengungkapkankembali isi bukuteks/bukuwajibtersebut.Pembelajarandanevaluasi menekankanpadahasil belajar. Evaluasi menekankanpadaresponpasif,ketrampilansecaraterpisah,danbiasanyamenggunakan paperand pencil test.Evaluasi hasil belajarmenuntutjawabanyangbenar.Maksudnyabila pebelajarmenjawabsecara“benar”sesuai dengankeinginanguru,hal ini menunjukkanbahwa pebelajartelahmenyelesaikantugasbelajarnya.Evaluasi belajardipandangsebagi bagianyang terpisahdari kegiatanpembelajaran,danbiasanyadilakukansetelahselesaikegiatanpembelajaran. Teori ini menekankanevaluasipadakemampuanpebelajarsecaraindividual. 1. A. Teori belajarKognitifistikdan Penerapannyadalam PembelajaranIPS Tidakseperti halnyabelajarmenurutperspektifbehaviorisdimanaperilakumanusiatundukpada peneguhandanhukuman,padaperspektif kognitifternyataditemui tiapindividujustrumerencakan responsperilakunya,menggunakanberbagai carayang bisamembantudiamengingatserta mengelolapengetahuansecaraunikdanlebihberarti.Teori belajaryangberasal dari aliranpsikologi kognitif ini menelaahbagaimanaorangberpikir,mempelajari konsep danmenyelesaikanmasalah. Hal yangmenjadi pembahasansehubungandenganteori belajarini adalahtentangjenis pengetahuandanmemori. 1. 1. JenisPengetahuan Menurutpendekatankognitif yangmutakhir,elementerpentingdalamprosesbelajaradalah pengetahuanyangdimilikiolehtiapindividukepadasituasi belajar.Dengankatalainapayangtelah kitadiketahui akansangatmenentukanapayangakanmenjadi perhatian,dipersepsi,dipelajari, diingatataupundilupakan.Pengetahuanbukanhanyahasil dari prosesbelajarsebelumnya,tapi juga akan membimbingprosesbelajarberikutnya.Berbagai risetterapantentanghal ini telahbanyak dilakukandanmakinmembuktikanbahwapengetahuandasaryangluasternyatalebihpenting dibandingstrategi belajaryangterbaik yangtersediasekalipun.Terlebihbilapengetahuandan wawasanyangluas ini disertai denganstrategi yangbaiktentuakanmembawahasil lebihbaiklagi tentunya. Perspektifkognitif membagi jenispengetahuanmenjadi tigabagian,yaitu:
  19. 19.  Pengetahuan Deklaratif, yaitupengetahuanyangbisadideklarasikanbiasanyadalambentuk kata atau singkatnyapengetahuankonseptual.  Pengetahuan Prosedural,yaitupengetahuantentangtahapanyangharusdilakukanmisalnya dalamhal pembagiansatubilanganataupuncara kitamengemudikansepeda,singkatnya “pengetahuanbagaimana”.  Pengetahuan Kondisional, adalahpengetahuandalamhal “kapandanmengapa” pengetahuandeklaratif danprosedural digunakan. Pengetahuandeklaratif rentangnyasangatberagam, bisaberupapengetahuantentangfakta (misalnya,bumi berputarmengelingi matahari dalamkurunwaktutertentu),generalisasi (setiap bendayangdi lemparke angkasaakan jatuhke bumi karenaadanya gaya gravitasi),pengalaman pribadi (apayangdiajarkanolehgurusainssecara menyenangkan) atauaturan(untukmelakukan operasi penjumlahandanpenguranganpadapecahanmakapembilangharusdisamakanterlebih dahulu). Menyatakanprosespenjumlahanataupenguranganpadabilanganpecahanmenunjukkan pengetahuandeklaratif,namunbilasiswamampumengerjakanperhitungantersebutmakadia sudahmemilikipengetahuanprosedural.Gurudansiswayangmampu menyelesaikansoal melalui rumustertentuatau menterjemahkanteksbahasaInggrisadalahcontohkemampuanpengetahuan prosedural lainnya.Sepertihalnyasiswayangmampuberenangdalamsatugayatertentu,berarti dia sudahmenguasai pengetahuanprosedural hal tersebut,dengankatalainpenguasaanpengetahuan ini jugadicirikanolehpraktekyangdilakukan. Sedangkanpengetahuankondisional adalahkemampuanuntukdapatmengaplikasikankeduajenis pengetahuandi atas.Dalammenyelesaikanpersoalanperhitungankimiamisalnya,siswaharus dapat mengidentifikasi terlebihdahulupersamaanapayangperludipakai (pengetahuandeklaratif) sebelummelakukanprosesperhitungan(pengetahuanprosedural).Pengetahuankondisionalini jadinyamerupakanhal yangpentingdimiliki siswa,karenamenentukanpenggunaankonsepdan proseduryangtepat.Terkadangsiswamengetahui faktadandapatmelakukansatuprosedur pemecahanmasalahtertentu,namunsayangnyamengaplikasikannyapadawaktudan tempatyang kurangtepat. Hal yangsangat pentingjadinyauntukmengidentifikasijenispengetahuaninibagi guruketika mengajar.Mempelajari informasitentangpokokbahasan tertentutidakselalumenyebabkansiswa akan menggunakaninformasi tersebut.Tidakjugalatihanmenyelesaikanbanyaksoal padatopik bahasantertentu,akanmembantumerekamemahamisatuprinsiplebihmendalam.Mengetahui sesuatutopik,mengetahui prosedural penyelesaianmasalahsertatahukapandanmengapa menggunakanpengetahuantersebutadalahhasil belajaryangberbeda-beda,dantentusajaini perludiajarkandengancarayang berbedapula. 1. 2. Model PengolahanInformasi Untuk menggunakantigajenispengetahuandi atas,tentunyakitaharusdapatmengingatnyadengan baik.Hal berikutnyateori belajaryangdibahasdalamperspektif kognitif ini adalahtentang bagaimanaindividumengingatdanbagianapa sajadari memori yangbekerjadalamprosesberpikir seperti padapemecahanmasalah.Model pengolahaninformasimerupakansalahsatumodel dari perspektif teoribelajarini yangmenjelaskankerjamemori manusiasesuai dengananalogi komputer,
  20. 20. yang meliputitigamacamsistempenyimpananingatan:memori sensori, memori kerjadanmemori jangkapanjang. 1. Memori Sensoriadalahsistemmengingatstimuli secaracepatsehinggaanalisispersepsi dapat terjadi. 2. MemoriKerja atau memori jangkapendek,menyimpanlimasampai sembilaninformasi padasatu waktusampai sekitar20 detik,yangcukuplamauntukpengolahaninformasi terjadi.Informasi yang dikodekan(decode) sertapersepsi tiapindividuakanmenentukanapayangperludisimpandi memori kerjaini. 3. MemoriJangka Panjang menyimpaninformasi yangsangatbesardalamwaktuyanglama. Informasi di dalamnyadisimpandalambentuksecaraverbal danvisual. Memori Sensori Memori sensori adalahsistemyangbekerjaseketikamelaluialatinderadinamakitamemberikanarti kepadastimuli yangdatangdinamakan persepsi. Arti yangdiberikanberasaldari realitasobjektif sertadari pengetahuankitasebelumnya.Contohnya,suatusymbol ‘l’akandipersepsi sebagai huruf alpabettertentukalaukitamenggolongkannyadalamurutanj,k.l,m; namundalam kesempatan berbedaseperti l,2,3, 4 maka symbol yangsamabermaknaangka satu.Memori sensori akan menangkapstimuli danmempersepsi,ataumemberikanmakna;dalamhal ‘l’konteksdan pengetahuankitaakanmenentukanmaknayangakandiberikan,bagi seseorangyangtidak mempunyai pengetahuantentangangkaatauhuruf,maka symbol itukemungkinantidakbermakna apapun.MisalnyateksyangAndabaca saat ini akandipersepsi berbedaolehoranglainyangtidak mengerti bahasaIndonesiaataupunyangbutahuruf,walaupunmatanyamelihatderetansimbol yang samaseperti Anda;ataupunsaat kitamembacahuruf kanji dari koran berbahasaJepang dimanakitatidakpunyakemampuanuntukmemahaminya.Memori sensoritidakhanyabekerja untuksimbol sajanamunjugadalamhal warna,gerakan,suara, bau,suhudan lainnyayang semuanyaharusdipersepsisecarasimultan.Namunkarenaketerbatasankemampuan,kitahanya dapat memfokuskanpadabeberapastimuli sajadanmengingkari yanglainnya.Hal ini menunjukkan bahwaperhatiansangatlahselektif;dengankatalainsaatperhatianpenuhsangatdiperlukan, biasanyastimuli lainnyaakanditolak. Perhatianadalahtahappertamadalambelajar.Siswatidakdapatmemahami apayangmerekatidak kenali atautidakdapatdipersepsi.Tentunyabanyakfaktoryangmempengaruhi perhatiansiswa. Tampilanatauaksi yangdramatisdapat mencuri perhatiansiswapadaawal pembelajaran.Cara lainnyaadalahmelalui perlakuanpadakatayang diucapkanatauditulisolehgurudenganwarna yang kontras,digarisbawahi atauditandai;memangilsiswasecaraacak,memberikankejutansiswa, menanyakanhal yangmenantang,memberikanmasalahyangdilematis,mengubahmetoda mengajardantugas, mengubahfrekuensi suaradanjedanyaakandapatmembantumenarik perhatiandari siswa.Namunmenarikperhatian siswaadalahhal pertama,membuatmerekauntuk tetapfokuspada pelajarandantugasnyajugahal yang kritisberikutnyaharusdilakukanolehguru. Maslow Teori Maslowdidasarkanpadaasumsi bahwadi dalamdiri individuadaduahal,yaitu:
  21. 21. (1) suatuusaha yangpositif untukberkembang (2) kekuatanuntukmelawanataumenolakperkembanganitu. Maslowmengemukakanbahwaindividuberperilakudalamupayauntukmemenuhikebutuhanyang bersifathirarkis.Padadiri masing-masingorangmempunyaiberbagai perasaantakutsepertirasa takut untukberusahaatauberkembang,takutuntukmengambil kesempatan,takutmembahayakan apa yang sudahia miliki dansebagainya,tetapi di sisilainseseorangjugamemiliki doronganuntuk lebihmajuke arah keutuhan,keunikandiri, ke arahberfungsinyasemuakemampuan,ke arah kepercayaandiri menghadapidunialuardanpadasaat itu jugaia dapat menerimadiri sendiri(self). Maslowmembagi kebutuhan-kebutuhan(needs) manusiamenjaditujuhhirarki.Bilaseseorangtelah dapat memenuhi kebutuhanpertama,seperti kebutuhanfisiologis,barulahiadapatmenginginkan kebutuhanyangterletakdi atasnya,ialahkebutuhanmendapatkanrasamandan seterusnya. Hierarki kebutuhanmanusiamenurutMaslow ini mempunyai implikasiyangpentingyangharus diperharikanolehgurupadawaktuiamengajaranak-anak.Iamengatakanbahwaperhatiandan motivasi belajarini mungkinberkembangkalaukebutuhandasarsi siswabelumterpenuhi. Carl RansomRogers Carl RansomRogers (1902-1987) lahirdi Oak Park, Illinoispadatanggal 8Januari 1902 di sebuah keluargaProtestanyangfundamentalis.Kepindahandari kotake daerahpertaniandiusianyayang ke-12,membuatiasenangakan ilmupertanian.Iapunbelajarpertaniandi UniversitasWisconsin. Setelahluluspadatahun1924, ia masukke UnionTheologySeminarydi BigApple danselamamasa studinyaiajugamenjadi seorangpastordi sebuahgerejakecil.Meskipunbelajardi seminari,ia malahikutkuliahdi TeacherCollege yangbertetanggadenganseminarinya. Tahun 1927, Rogersbekerjadi Institute forChildGuindance danmengunakanpsikoanalisaFreud dalamterapinyameskipuniasendiri tidakmenyetujui teori Freud.Padamasaini,Rogersjugabanyak dipengaruhi olehOttoRankdanJohn Deweyyangmemperkenalkanterapi klinis.Perbedaanteori yang didapatkannyajustrumembuatnyamenemukangbenangmerahyangkemudiandipakaiuntuk mengembangkanteorinyakelak.
  22. 22. Tahun 1957, Rogerspindahke UniversitasWisconsinuntukmengembangkanidenyatentang psikiatri.Setelahmendapatgelardoktor,Rogersmenjadi profesorpsikologidi Universitas UniversitasNegeriOhio.Kepindahandari lingkungankliniske lingkunganakademikmembuatRogers mengembangkanmetode client-centeredpsychotherapy.Disini dialebihsenangmenggunakan istilahklienterhadaporangyangberkonsultasidibandingkanmemakaiistilahpasien. Rogersmembedakanduatipe belajar,yaitu: Kognitif (kebermaknaan) Experiential( pengalamanatausignifikansi) Kecewakarenatidakbisamenyatukanpsikiatri dengan psikolog,Rogerspindahke Californiatahun 1964 dan bergabungdenganWesternBehavioral Science Institute.Ialalumengembangkanteorinya ke bidangpendidikan.Selainituiabanyakmemberikanworkshopdi Hongaria,Brazil,AfrikaSelatan, dan bahkanke eksUni Soviet. Rogerswafatpadatanggal 4 Februari 1987. Teori HumanistikCarl Rogers Meskipunteori yangdikemukanRogersadalahsalahsatudari teori holistik,namunkeunikanteori adalahsifathumanisyangterkandungdidalamnya.Teori humanistikRogerspunmenpunyai berbagai namaantara lain: teori yang berpusatpadapribadi (personcentered),non-directive,klien (client-centered),teori yangberpusatpadamurid(student-centered), teori yangberpusatpada kelompok(groupcentered),danpersontoperson).Namunistilahpersoncenteredyangsering digunakanuntukteori Rogers. Rogersmenyebutteorinyabersifathumanisdanmenolakpesimisme suramdanputusasadalam psikoanalisissertamenentangteori behaviorisme yangmemandangmanusiaseperti robot.Teori humanisme Rogerslebihpenuhharapandanoptimistentangmanusiakarenamanusiamempunyai potensi-potensi yangsehatuntukmaju.Dasarteori ini sesuai denganpengertianhumanisme pada umumnya,dimanahumanismeadalahdoktrin,sikap,dancara hidup yangmenempatkannilai-nilai manusiasebagai pusatdanmenekankanpadakehormatan,hargadiri,dankapasitasuntuk merealisasikandiri untukmaksudtertentu.
  23. 23. Asumsi dasarteori Rogersadalah: - Kecenderunganformatif Segalahal di duniabaikorganik maupunnon-organiktersusundari hal-hal yanglebihkecil. - Kecenderunganaktualisasi Kecenderungansetiapmakhlukhidupuntukbergerakmenujuke kesempurnaanataupemenuhan potensial dirinya.Tiapindividual mempunyaikekuatanyangkreatifuntukmenyelesaikan masalahnya. StrukturKepribadianmenurutRogers Sejakawal Rogersmengamati bagaimanakepribadianberubahdanberkembang,danadatiga konstrukyangmenjadi dasarpentingdalamteorinya:Organisme,Medanfenomena,danself. 1. Organisme Pengertianorganismemencakuptigahal: makhlukhidup organisme adalahmahkluklengkapdenganfungsifisikdanpsikologisnyadanmerupakantempat semuapengalaman,potensi yangterdapatdalamkesadaransetiapsaat,yakni persepsi seseorang mengenai kejadianyangterjadi dalamdiri danduniaeksternal RealitasSubyektif
  24. 24. Oranisme menganggapduniaseperti yangdialamidandiamatinya.Realitaadalahpersepsiyang sifatnyasubyektif dandapatmembentuktingkahlaku. Holisme Organisme adalahsatu kesatuansistem, sehinggaperubahandalamsatubagianakanberpengaruh pada bagianlain.Setiapperubahanmemilikimaknapribadi danbertujuan,yaitutujuan mengaktualisasi,mempertahankan,danmengembangkandiri. 2. Medan Fenomena Medan fenomenaadalah keseluruhanpengalaman,baikyanginternal maupuneksternal,baik disadari maupuntidakdisadari.Medanfenomenaini merupakanseluruhpengalamanpribadi seseorangsepanjanghidupnyadi dunia,sebagaimanapersepsi subyektifnya. 3. Diri Konsepdiri mulai terbentukmulai masabalitaketikapotongan-potonganpengalamanmembentuk kepribadiannyadanmenjadi semakinmawasdiri akanidentitasdirinya begitubayi mulaibelajarapa yang terasabaikatau buruk,apa ia merasanyamanatau tidak.Jikastrukturdiri itusudah terbentuk, maka aktualisasi diri mulaiterbentuk.Aktualisasi diriadalahkecenderunganuntuk mengaktualisasikansangdiri sebagai manayangdirasakandalamkesadaran.Sehingga kecenderunganaktualisasi tersebutmengacukepadapengalamanorganikindividual,sebagai suatu kesatuanyangmenyeluruh,akankesadarandanketidak-sadaran,psikisdankognitif. Diri dibagi atas 2 subsistem: Konsepdiri yaitupenggabunganseluruhaspekkeberadaandanpengalamanseseorangyang disadari olehindividual (meski tidakselaluakurat). Diri ideal yaitucita-citaseseorangakandiri.
  25. 25. Terjadinyakesenjanganantarakonsepdiri dandiri ideal akanmenyebabkanketidak-seimbangandan kepribadianmenjadi tidaksehat. MenurutCarl Rogersada beberapahal yang mempengaruhi Self,yaitu: 1. Kesadaran Tanpa adanyakesadaran,makakonsepdiri dandiri ideal tidakakanada. Ada3 tingkatkesadaran. - Pengalamanyangdirasakandibawahambangsadarakan ditolakataudisangkal. - Pengalamanyangdapatdiaktualisasikansecarasimbolisakansecaralangsungdiakui olehstruktur diri. - Pengalamanyangdirasakandalambentukdistorsi.Jikapengalamanyangdirasakantidaksesuai dengandiri (self),makadibentukkembali dandidistorsikansehinggadapatdiasimilasikanoleh konsepdiri. 2. Kebutuhan - Pemeliharaan Pemeliharaantubuhorganismikdanpemuasannyaakanmakanan,air,udara,dan keamanan, sehinggatubuhcenderunginginuntukstatisdanmenolakuntukberkembang. - Peningkatandiri Meskipuntubuhmenolakuntukberkembang,namundiri jugamempunyai kemampuanuntuk belajardanberubah.
  26. 26. - Penghargaanpositif (positive regard) Begitukesadaranmuncul,kebutuhanuntukdicintai,disukai,atauditerimaolehoranglain. - Penghargaan diri yangpositif (positiveself-regard) Berkembangannyakebutuhanakanpenghargaandiri (self-regard) sebagai hasildari pengalaman dengankepuasanataufrustasi.Diri akanmenghindari frustasidenganmencari kepuasanakan positive self-regard. 3. Stagnasi Psikis Stagnasi psikisterjadi bila: - ada ketidakseimbanganantarakonsepdiri denganpengalamanyangdirasakanolehdiri organis. - Ketimpanganyangsemakinbesarantarakonsepdiri denganpengalamanorganismembuat seseorangmenjadi mudahterkenaserangan.Kurangakankesadarandiri akanmembuatseseorang berperilakutidaklogis,bukanhanyauntukoranglainnamunjugauntukdirinya. - Jika kesadarandiri tersebuthilang,makamuncul kegelisahantanpasebabdanakanmemuncak menjadi ancaman. Untuk mencegahtidakkonsistennyapengalamanorganikdengankonsepdiri,makaperludiadakan pertahanandiri dari kegelisahandanancamanadalah penyangkalandandistorsi terhadap pengalamanyangtidakkonsisten.Distorsi adalahsalahinterpretasi pengalamandengankonsepdiri, sedangkanpenyangkalanadalahpenolakanterhadappengalaman.Keduanyamenjagakonsistensi antara pengalamandankonsepdiri supayaberimbang. Cara pertahananadalahkarakteristikuntukorangnormal danneurotik.Jikaseseoranggagal dalam menerapkanpertahanantersebut,makaindividuakanmenjadi tidakterkendali ataupsikotik. Individudipaksakanuntukmenerimakeadaanyangtidaksesuai dengankonsepdirinyaterus
  27. 27. menerusdanakhirnyakonsepdirinyamenjadihancur.Perilakutidakterkendali ini dapatmuncul mendadakataudapat pulamuncul bertahap. DinamikaKepribadian 1. PenerimaanPositif (PositiveRegard) → Orangmerasapuas menerimaregardpositif, kemudianjugamerasapuasdapatmemberi regardpositif kepadaoranglain. 2. Konsistensi danSalingsuai Self (Self ConsistensyandCongruence)→ organisme berfungsi untukmemeliharakonsistensi(keajegkan=keadaantanpakonflik) dari persepsi diri,dankongruen (salingsuai) antarapersepsi self dengan pengalaman. 3. Aktualisasi Diri (Self Actualization) → Freudmemandangorganisme sebagai sistemenergi, dan mengembangkanteori bagaimanaenergi psikikditimbulkan,ditransferdandisimpan.Rogers memandangorganisme terusmenerusbergerakmaju.Tujuantingkahlakubukanuntukmereduksi teganganenerji tetapi mencapaiaktualisasi diri yaitukecenderungandasarorganisme untuk aktualisasi:yakni kebutuhanpemeliharaan(maintenance) danpeningkatandiri (enhancement). PerkembanganKepribadianmenurut Rogers Rogersmeyakini adanyakekuatanyangtumbuhpadasemuaorangyangmendorongoranguntuk semakinkompleks,ekspansi,sosial,otonom,dansecarakeselutuhansemakinmenujuaktualisasi diri atau menjadi Pribadi yangberfungsi utuh(FullyFunctioningPerson) Ada limaciri kepribadianyangberfungsi sepenuhnya: Terbukauntukmengalami (openesstoexperience) Orang yangterbukauntukmengalami mampumendengardirinyasendiri,merasakanmendalam, baikemosional maupunkognitiftanpamerasaterancam.Mendengarorangmembual menimbulkan rasa muak tanpaharus diikuti perbuatanuntukmelampiaskanrasamuaktersebut. Hidupmenjadi (Existential living).
  28. 28. Kecenderunganuntukhidupsepenuhnyadanseberisi mungkinpadaseiapeksistensi.Disini orang menjadi fleksibel,adaptable,toleran,danspontan. KeyakinanOrganismik(Organismictrusting) Orang mengambil keputusanberdasarkanpengalamanorganismiknyasendiri,mengerjakanapa yang dirasanyabenarsebagai bukti kompetensi dankeyakinannyauntuk mengarahkantingkahlaku. Orang mampumemakai perasaanyangterdalamsebagai sumberutamamembuatkeputusan. Pengalamankebebasan( Experiental Freedom). Pengalamanhidupbebasdengancarayangdiinginkansendiri,tanpaperasantertekanatau terhambat.Orangitu melihatbanyakpilihanhidupdanmerasamampumengerjakanapayangingin dikerjakannya. Kreatifitas(Creativity) Merupakankemasakanpsikologikyangoptimal.Orangdengangoodlife kemungkinanbesar memunculkanprodukkreatifdanhidup kreatif. Terapi yang Diberikan Seperti disebutkandi atas,bahwaRogersmenolakpsikoanalisisFreuddanbehaviorisdalam teorinya,sehinggaterapi yangdigunakannyajugaberbeda.Rogerstidakmempermasalahkan bagaimanaklienmenjadiseperti ini,namunlebihmenekankanbagaimanaklienakanberubah. Terapishanyamenolongdanmengarahkankliendanyangmelakukanperubahanadalahklienitu sendiri.Itulahsebabnyateori Rogersdisebutsebagaiperson-centeredtheory. KesimpulanTeori HumanistikCarl Rogers 1. Teori Rogersdisebuthumaniskarenateori ini percayabahwasetiapindividuadalahpositif,serta menolakteori Freuddanbehaviorisme.
  29. 29. 2. Asumsi dasarteori Rogersadalahkecenderunganformatif dankecenderunganaktualisasi. 3. Diri (self) adalah terbentukdari pengalamanmulai dari bayi,di manadiri terdiri dari 2 subsistem yaitukonsepdiri dandiri ideal. 4. Kebutuhanindividuada4 yaitu: (1) pemeliharaan,(2) peningkatandiri,(3) penghargaanpositif (positive regard),dan(4) Penghargaan diri yangpositif (positive self-regard) 5. Stagnasi psikisterjadi bilaterjadi karenapengalamandankonsepdiri yangtidakkonsistendan untukmenghindarinyaadalahpertahanan(1) distorsi dan(2) penyangkalan.Jikagagal dalam menerapkanpertahanantersebutkonsepdiri akanhancurdan menyebabkanpsikotik. 6. Dalamterapi,terapishanyamenolongdanmengarahkankliendanyangmelakukanperubahan adalahklienitusendiri. Aplikasi Teori HumanistikCarl RogerDalamPembelajaranIPS Teori Rogerdalam pembelajaranadalahdibutuhkannya3sikapdalamfasilitatorbelajaryaitu(1) realitasdi dalamfasilitatorbelajar,(2) penghargaan,penerimaan,dankepercayaan,dan(3) pengertianyangempati. - Realitasdi dalamfasilitatorbelajar Merupakansikapdasar yang penting.Seorangfasilitatormenjadi dirinyasendiri dantidak menyangkal diri sendiri,sehinggaiadapatmasukkedalamhubungandenganpelajartanpaada sesuatuyangditutup-tutupi. - Penghargaan,penerimaan,dankepercayaan
  30. 30. Menghargai pendapat,perasaan,dansebagainyamembuattimbulnyapenerimaanakansatudengan lainnya.Denganadanyapenerimaantersebut,makaakanmuncul kepercayaanakansatudengan lainnya. - Pengertianyangempati Untuk mempertahankaniklimbelajaratasdasar inisiatif diri,makaguruharusmemilikipengertian yang empati akanreaksi muriddari dalam.Guru harusmemiliki kesadaranyangsensitif bagi jalannya prosespendidikandengantidakmenilai ataumengevaluasi.Pengertianakanmateri pendidikan dipandangdari sudutmuriddan bukanguru. Guru menghubunganpengetahuanakademikke dalampengetahuanterpakai seperti memperlajari mesindengantujuanuntukmemperbaikai mobil.Experiential Learningmenunjukpadapemenuhan kebutuhandankeinginansiswa.Kualitasbelajarexperiential learningmencakup:keterlibatansiswa secara personal,berinisiatif,evaluasiolehsiswasendiri,danadanyaefekyangmembekaspada siswa. MenurutRogersyang terpentingdalamprosespembelajaranadalahpentingnyaguru memperhatikanprinsippendidikandanpembelajaran,yaitu: 1. Menjadi manusiaberarti memilikikekuatanyangwajaruntukbelajar.Siswatidakharusbelajar tentanghal-hal yangtidakada artinya. 2. Siswaakan mempelajari hal-hal yangbermaknabagi dirinya.Pengorganisasianbahanpelajaran berarti mengorganisasikanbahandanide barusebagai bagianyangbermaknabagi siswa 3. Pengorganisasianbahanpengajaranberarti mengorganisasikanbahandanide barusebagai bagianyang bermaknabagi siswa. 4. Belajaryangbermaknadalammasyarakatmodernberarti belajartentangproses. Dari bukunyaFreedomToLearn,ia menunjukkansejumlahprinsip-prinsipdasarhumanistikyang pentingdiantaranyaialah:
  31. 31. a. Manusiaitumempunyai kemampuanbelajarsecaraalami. b. Belajaryang signifikanterjadi apabilamateri pelajarandirasakanmuridmempunyai relevansi denganmaksud-maksudsendiri. c. Belajaryangmenyangkutperubahandi dalampersepsi mengenaidirinyasendiri diangap mengancamdancenderunguntukditolaknya. d. Tugas-tugasbelajaryangmengancamdiri ialahlebihmudahdirasakandandiasimilasikanapabila ancaman-ancamandari luar itusemakinkecil. e. Apabilaancamanterhadapdiri siswarendah,pengalamandapatdiperolehdenganberbagai cara yang berbeda-bedadanterjadilahprosesbelajar. f. Belajaryang bermaknadiperolehsiswadenganmelakukannya. g. Belajardiperlancarbilamanasiswadilibatkandalamprosesbelajardanikutbertanggungjawab terhadapprosesbelajaritu. h. Belajarinisiatif sendiriyangmelibatkanpribadisiswaseutuhnya,baikperasaanmaupunintelek, merupakancara yang dapatmemberikanhasil yangmendalamdanlestari. i. Kepercayaanterhadapdiri sendiri,kemerdekaan,kreativitas,lebihmudahdicapai terutama jika siswadibiasakanuntukmawasdiri danmengritikdirinyasendiri danpenilaiandari oranglain merupakancara keduayangpenting. j. Belajaryang palingbergunasecarasosial di dalamduniamodernini adalahbelajarmengenai prosesbelajar,suatu keterbukaanyangterusmenerusterhadappengalamandanpenyatuannyake dalamdiri sendiri mengenai prosesperubahanitu.
  32. 32. Salahsatu model pendidikanterbukamencakupkonsepmengajarguruyangfasilitatifyang dikembangkanRogersditeliti olehAspydanRoebuckpadatahun1975 mengenai kemampuanpara guru untukmenciptakankondisi yangmendukungyaituempati,penghargaandanumpanbalik positif. Ciri-ciri guruyangfasilitatif adalah: Meresponperasaansiswa Menggunakanide-idesiswauntukmelaksanakaninteraksi yangsudahdirancang Berdialogdanberdiskusi dengansiswa Menghargai siswa Kesesuaianantaraperilakudanperbuatan Menyesuaikanisi kerangkaberpikirsiswa(penjelasanuntukmementapkankebutuhansegeradari siswa) Tersenyumpadasiswa Dari penelitianitudiketahuiguruyangfasilitatif mengurangi angkabolossiswa,meningkatkanangka konsepdiri siswa,meningkatkanupayauntukmeraihprestasi akademiktermasukpelajaranbahasa dan matematikayangkurangdisukai,mengurangitingkatproblemyangberkaitandengandisiplin dan mengurangi perusakanpadaperalatansekolah,sertasiswamenjadi lebihspontandan menggunakantingkatberpikiryanglebihtinggi. Implikasi Teori BelajarHumanistik a. Guru Sebagai Fasilitator Psikologi humanistikmemberi perhatianatasgurusebagai fasilitator. Berikutini adalahberbagai cara untukmemberi kemudahanbelajardanberbagai kualitasfasilitator.Ini merupakanikhtisaryang sangat singkatdari beberapa(petunjuk): 1. Fasilitatorsebaiknyamemberi perhatiankepadapenciptaansuasanaawal,situasi kelompok,atau pengalamankelas
  33. 33. 2. Fasilitatormembantuuntukmemperolehdanmemperjelastujuan-tujuanperorangandi dalam kelasdanjuga tujuan-tujuankelompokyangbersifatumum. 3. Dia mempercayai adanyakeinginandari masing-masingsiswauntukmelaksanakantujuan-tujuan yang bermaknabagi dirinya,sebagai kekuatanpendorong,yangtersembunyi di dalambelajaryang bermaknatadi. 4. Dia mencobamengaturdanmenyediakansumber-sumberuntukbelajaryangpalingluasdan mudahdimanfaatkanparasiswauntukmembantumencapai tujuanmereka. 5. Dia menempatkandirinyasendiri sebagaisuatusumberyangfleksibel untukdapatdimanfaatkan olehkelompok. 6. Di dalammenanggapi ungkapan-ungkapandi dalamkelompokkelas,danmenerimabaikisi yang bersifatintelektual dansikap-sikapperasaandanmencobauntukmenanggapi dengancarayang sesuai,baikbagi individual ataupunbagi kelompok 7. Bilamanacuaca penerimakelastelahmantap,fasilitatorberangsur-sngsurdapatberperanan sebagai seorangsiswayangturutberpartisipasi,seoranganggotakelompok,danturutmenyatakan pendangannyasebagai seorangindividu,seperti siswayanglain. 8. Dia mengambil prakarsauntukikutsertadalam kelompok,perasaannyadanjugapikirannya dengantidakmenuntutdanjugatidakmemaksakan,tetapi sebagai suatuandilsecarapribadi yang bolehsajadigunakanatauditolakolehsiswa 9. Dia harustetap waspadaterhadapungkapan-ungkapanyangmenandakan adanyaperasaanyang dalamdan kuat selamabelajar 10. Di dalamberperansebagai seorangfasilitator,pimpinanharusmencobauntukmenganali dan menerimaketerbatasan-keterbatasannyasendiri. Aplikasi Teori HumanistikTerhadapPembelajaranSiswa
  34. 34. Aplikasi teori humanistiklebihmenunjukpadaruhatau spiritselamaprosespembelajaranyang mewarnai metode-metodeyangditerapkan.Perangurudalampembelajaranhumanistikadalah menjadi fasilitatorbagi parasiswasedangkangurumemberikanmotivasi,kesadaranmengenai maknabelajardalamkehidupansiswa.Gurumemfasilitasipengalamanbelajarkepadasiswadan mendampingi siswauntukmemperolehtujuanpembelajaran. Siswaberperansebagai pelakuutama(studentcenter) yangmemaknai prosespengalaman belajarnyasendiri.Diharapkansiswamemahamipotensidiri ,mengembangkanpotensi dirinya secara positif danmeminimalkanpotensi diri yangbersifatnegatif. Tujuanpembelajaranlebihkepadaprosesbelajarnyadaripadahasilbelajar.Adapunprosesyang umumnyadilalui adalah: Merumuskantujuanbelajaryangjelas Mengusahakanpartisipasi aktif siswamelalui kontrakbelajaryangbersifatjelas,jujurdanpositif. Mendorongsiswauntukmengembangkankesanggupansiswauntukbelajaratasinisiatif sendiri Mendorongsiswauntukpekaberpikirkritis,memaknaiprosespembelajaransecaramandiri Siswadi dorong untukbebasmengemukakanpendapat,memilihpilihannyasendiri,melakukkan apa yang diinginkandanmenanggungresikodariperilakuyangditunjukkan. Guru menerimasiswaapaadanya,berusahamemahami jalanpikiransiswa,tidakmenilaisecara normatif tetapi mendorongsiswauntukbertanggungjawabatassegalaresikoperbuatanatauproses belajarnya. Memberikankesempatanmuriduntukmajusesuai dengankecepatannya Evaluasi diberikansecaraindividual berdasarkanperolehanprestasi siswa Pembelajaranberdasarkanteori humanistikini cocokuntukditerpkanpadamateri-materi pembelajaranyangbersifatpembentukankepribadian,hati nurani,perubahansikap,dananalisis terhadapfenomenasosial.Indikatordari keberhasilanaplikasi ini adalahsiswamerasasenang bergairah,berinisiatif dalambelajardanterjaadi perubahanpolapikir,perilakudansikapatas kemauansendiri. Siswadiharapkanmenjadi manusiayangbebas,berani,tidakterikatolehpendapatoranglaindan mengaturpribadinyasendiri secarabertanggungjawabtanpamengurangihak-hakoranglainatau melanggaraturan, norma , disiplinatauetikayangberlaku.
  35. 35. Ciri-ciri guruyangbaikdan kurangbaikmenurutHumanistik Guru yang baikmenurutteori ini adalah:Guru yang memiliki rasahumor,adil,menarik,lebih demokratis,mampuberhubungandengansiswadenganmudahdanwajar.Ruangkeladslebih terbukadan mampumenyesuaikan padaperubahan. Sedangkanguru yang tidakefektif adalahguruyangmemilikirasahumoryang rendah,mudah menjadi tidaksabar,sukamelukai perasaansiswaadengankomentsrysngmenyakitkan,bertindak agak otoriter,dankurangpekaterhadapperubahanyangada. Prinsip- prinsipbelajarhumanistik: 1. Manusia mempunyai belajaralami 2. Belajarsignifikanterjadi apabilamateri plajarandirasakanmuridmempuyai relevansi dengan maksudtertentu 3. Belajaryangmenyangkutperubahandi dalampersepsimengenai dirinya 4. Tugas belajaryangmengancamdiri ialahlebihmudahdirasarkanbilaancamanitukecil 5. Bilabancaman iturendahterdapatpangalamansiswadalammemperolehcaar 6. Belajaryangbermakna diperolaehjikasiswamelakukannya 7. Belajarlancar jikasiswadilibatkandalamprosesbelajar 8. Belajaryangmelibatkansiswaseutuhnyadapatmemberi hasil yangmendalam
  36. 36. A. Teori BelajarSibernetikdanPenerapannyadalamPembelajaranIPS Teori belajarsibernetikmerupakanteori belajar yangrelatif barudibandingkanteori-teoribelajar lainnya.Teori ini berkembangsejalandenganperkembanganteknologi danilmuinformasi.Menurut teori sibernetik,belajaradalahpemrosesaninformasi.Teori ini lebihmementingkansisteminformasi dari pesanataumateri yang dipelajari.Bagaimanaprosesbelajarakanberlangsungsangat ditentukanolehsisteminformasidari pesantersebut.Olehsebabitu,teorisibernetikberasumsi bahwatidakada satu jenispuncarabelajaryangideal untuksegalasituasi.Sebabcarabelajarsangat ditentukanolehsisteminformasi. Sekilas,teori ini mempunyai kesamaandenganteori kognitifyangmementingkanproses.Proses memangpentingdalamteori sibernetik,namun,yanglebihpentinglagi adalahsisteminformasi yang diproses.Informasi inilahyangakanmenentukanproses. Asumsi laindari teori Sibernetikiniadalahbahwatidakadasatu prosesbelajarpunyangideal untuk segalasituasi,yangcocokuntuksemuasiswa.Olehkarenaitu,sebuahinformasi mungkinakan dipelajari olehseorangsiswadengansatumacamprosesbelajar,daninformasi yangsamaitu mungkinakandipelajari siswalainmelaluiprosesbelajaryangberbeda. Komponenpemrosesaninformasi dipilahberdasarkanperbedaanfungsi,kapasitas,bentuk informasi,sertaprosesterjadinya. Ketigakomponentersebutadalah: SensoryReceptor(SR) SensoryReceptor(SR) merupakansel tempatpertamakali informasiditerimadari luar.Di dalamSR informasi ditangkapdalambentukaslinya,bertahandalamwaktusangatsingkat,daninformasi tadi mudahtergangguatau berganti. WorkingMemory (WM)
  37. 37. WorkingMemory(WM) diasumsikanmampumenangkapinformasi yangdiberi perhatianoleh individu.KarakteristikWMadalahmemiliki kapasitasterbatas(informasi hanyamampubertahan kuranglebih15 detiktanpapengulangan) daninformasi dapatdisandidalambentukyangberbeda dari stimulusaslinya.Artinyaagarinformasi dapatbertahandalamWM, upayakanjumlahinformasi tidakmelebihi kapasitasdisampingmelakukanpengulangan. Long Term Memory(LTM) Long TermMemory (LTM) diasumsikan; 1) berisi semuapengetahuanyantelahdimiliki individu, 2) mempunyai kapasitastidakterbatas, 3) sekali informasi disimpandi dalamLTMia tidakakanpernahterhapusatau hilang. Bahwa prosespengolahaninformasidalamingatandimulai dari prosespenyandianinformasi (encoding),diikuti denganpenyimpananinformasi (storage),dandiakhiri denganmengungkapkan kembali informasi-informasi yangtelahdisimpandalamingatan(retrieval).Ingatanterdiridari strukturinformasi yangterorganisasi danprosespenelusuranbergeraksecarahirarkhis,dari informasi yangpalingumumdaninklusif ke informasi yangpalingumumdanrinci,sampai informasi yang diinginkandiperoleh. Teori ini telahdikembangkanolehparapenganutnya,antaralainseperti pendekatan-pendekatan yang berorientasipadapemrosesaninformasi yangdikembangkanolehGage danBerliner,Biehler dan Snowman,Baine,sertaTennyson. Dalambentuknyayanglebihpraktis,teori ini misalnyatelahdikembangkanolehLanda(dalam pendekatanyangdisebutalgoritmikdanheuristik),paskdanScott(denganpembagiansiswatipe menyeluruhatauwholistdantipe serial atauserialist),ataupendekatan-pendekatanlainyang berorientasi padapengolahaninformasi. 1. TokohAliranSibernetik
  38. 38. a. Landa Landa merupakansalahseorangahli Psikologi yangberaliranSibernetik.MenurutLanda,adadua macam prosesberpikir.Pertama,disebutprosesberpikiralgoritmik,yaituprosesberpikir linier, konvergen,lurusmenujuke satutargettertentu.Jeniskeduaadalahcaraberpikirheuristik,yakni cara berpikirdivergen,menujukebeberapatargetsekaligus(Budiningsih,2002:81). Prosesbelajarakanberjalandenganbaikjikaapayanghendakdipelajariituataumasalahyang hendakdipecahkan(ataudalamistilahyanglebihteknisyaitusisteminformasi yangendakdipelajari) diketahui ciri-cirinya.Satuhal lebihtepatapabiladisajikandalambentuk“terbuka”danmemberi keleluasaansiswauntukberimajinasidanberpikir.Misalnya,agarsiswamampumemahami sebuah rumusmatematika,biasanayamengikuti urutantahapdemi tahapyangsudahteraturdan mengarah kesatutargettertentu.Namun,utukmemahami maknasuatukonsepyangluasdanbanyakmemiliki interpretasi (misalnyakonsep“masyarakat”),makaakanlebihbaikjikaprosesberpikirsiswa dibimbingke arahyang“menyebar”(heuristik),denganharapanpemahamanmerekaterhadap konsepitutidaktunggal,monoton,dogmatis,danlinier. b. Pask dan Scott Ahli lainadalahyangpemikirannyaberaliransibernetikadalahPaskdanScott.Pendekatanserialis yang diusulkanolehPaskdanScottsama denganpendekatanalgoritmik.Namun,caraberpikir menyeluruh(wholist) tidaksamadenganheuristik.Cara berpikirmenyeluruhadalahberpikiryang cenderungmelompatke depan,langsungke gambaranlengkapsebuahsisteminformasi.Ibarat melihatlukisan,bukandetail-detail yangkitaamati lebihdahulu,tetapiseluruhlukisanitusekaligus, baru sesudahituke bagian-bagianyanglebihkecil. Pendekatanyangberorientasi padapengelolaaninformasimenekankanbeberapahal seperti ingatan jangkapendek(shorttermmemory),ingatanjangkapanjang(longtermmemory),dansebagainya, yang berhubungandenganapayang terjadi dalamotakkitadalamprosespengolahaninformasi.Kita lihatpengaruhaliranNeurobiologissangatterasadi sini.Namun,menurutteori sibernetikini,agar prosesbelajarberjalanseoptimalmungkin,bukanhanyacarkerjaotak kitayang perludipahami, tetapi jugalingkunganyangmempengaruhi mekanisme itupunperludiketahui. Siswatipe wholistataumenyeluruhcenderungmempelajari sesuatudari tahapyangpalingumum kemudianbergerakke yanglebihkhusus.Sedangkansiswatipe serialistcenderung berpikirsecara algoritmik
  39. 39. PenerapanTeori BelajarSibernetikDalamPembelajaranIPS Teori belajarpemrosesaninformasimendeskripsikantindakanbelajarmerupakanprosesinternal yang mencakupbeberapatahapan.Sembilantahapandalamperistiwa pembelajaransebagai cara- cara eksternal yangberpotensi mendukungproses-prosesinternaldalamkegiatanbelajaradalah (Suciati,2001:34) : 1. Menarik perhatian 2. Memberitahukantujuanpembelajarankepadasiswa 3. Merangsangingatanpada pra syarat belajar 4. Menyajikanbahanperansang 5. Memberikanbimbinganbelajar 6. Mendorongunjukkerja 7. Memberikanbalikaninformative 8. Menilai unjukkerja 9. Meningkatkanretensi danalihbelajar. Aplikasi teori belajarsibernetikdalampembelajaranIPS ialah: Menentukantujuan-tujuaninstruksional.
  40. 40. Menentukanmetode pelajaran. Mengkaji sisteminformasiyangterkandungdalammateri tersebut. Menentukanpendekatanbelajaryangsesuai dengansisteminformasi itu(apakahalgoritmik ataukahheuristik). Menyusunmateri pelajarandalamurutanyangsesuai dengansisteminformasinya. Menyajikanmateri danmembimbingsiswabelajardenganpolayangsesuai denganurutanmateri pelajaran. KelebihanTeori Sibernetik Cara berfikiryangberorientasipadaproseslebihmenonjol. Penyajianpengetahuanmemenuhi aspekekonomis. Kapabilitasbelajardapatdisajikanlebihlengkap. Adanyaketerarahanseluruhkegiatankepadatujuanyangingindicapai. Adanyatransferbelajarpadalingkungankehidupanyangsesungguhnya. Kontrol belajarmemungkinkanbelajarsesuaidenganiramamasing-masingindividu Balikaninformative memberikanrambu-rambuyangjelastentangtingkatunjukkerjayangtelah dicapai dibandingkandenganunjukkerjayangdiharapkan. KelemahanTeori Sibernetik Teori ini dikritikkarenalebihmenekankanpadasisteminformasi yangdipelajari,dankurang memperhatikanbagaimanaprosesbelajar.Selainituteori ini tidakmembahasprosesbelajarsecara langsungsehinggahal ini menyulitkanpenerapannya. 1. Kepercayaanpadadiri pada siswaditumbuhkandenganmembiasakanuntukmawasdiri 2. Belajarsosial adalahbelajarmengenai prosesbelajar
  41. 41. C. PenerapanTeori BelajarMental dalamPembelajaranIlmuPengetahuanSosial Teori belajardisiplinmentalmenjadi dasaruntukdisusunnyastrategi danmodel pembelajaranuntuk diterapkanbagi siswa.Model pembelajaranyangdimaksudadalahsuatuperencanaanatausuatu polayang menggunakanpembelajaradi kelasataupembelajarandalamtutorial sertauntuk menentukanperangkat-perangkatpembelajaran(Triyanto,2007: 1). Dalamkalangananak-anak,baikdi lingkungankeluargaataupundi sekolah,hampirsemuaaspek pembelajaranbisadilakukandengancaradisiplin,seperti pembiasaansecaratetapakansuatu pekerjaan,latihantetapterhadapsuatuketerampilan,disiplindiri dalambertindak,displin mengendalikandiri,bekerjakerasdengandisiplintetap,sertaadanyaarahan-arahanmotivasidari pihaklain.Semuaitujikadilakukanakanmenghasilkanmanusiayangmemiliki kemampuanungguldi bidangyangdikerjakannyaataudilatihnyasecaradisiplintadi.Memang,padaasalnyadisiplin dilakukanolehadanyaaturan-aturaneksternal,namunsecaratidaklangsung,jikahal itudilakukan secara terusmenerusdalamwaktuyanglama,akan menghasilkanperilakudisiplininternal. Suatupekerjaanjikadikerjakansecaraterus menerusdenganfrekuensi yangrelatiftetap,akan menjadikannyaseseorangmenjadi terbiasadenganpekerjaannyaitu. Disiplinjugatidakhanya untukhal-hal yangbersifatpraktis,namunjugadapatbersifatmental.Sebagai contohnya,dengan telahmelakukan‘hafalan’secaradisiplinterhadapperkalianangka1x 1, sampai denganperkalian10 x 10, makakita sekarangtidakperluberpikirlagi jikaditanya,6x 7, 8 x 9, atau 7 x 7. Kita bisa langsungmenjawabhasilnyadenganbenar.Itusemuaakibatdari hasil belajarmelalui poladisiplin mental ketikakitadi SDdulu.Disiplinmentaldikenal jugadengandisiplinformal. Teori disiplinmental relevanapabiladiterapkandalamsistempembelajaran,karenakriteriabelajar bagi siswaadalahadanya perubahanperilakupadadiri individu,perubahanperilakuyangterjadi hasil dari pengalaman,danperubahantersebutrelatif menetap(Suciati,2005: 13). Berdasarkan kriteriatersebuttentusajateori belajardisiplinmental dapatditerapkansebagai mediauntuk menambahpengetahuanuntukperubahanperilakuindividusecaramenetapdanberdasarkanhasil pengalamandalamprosesbelajarmengajar. Dalamranah pembelajaranIlmuPengetahuanSosial,teori disiplinmental menjadi dasardalam pembelajaran,yaitudenganmenggunakanstrategi gurumemberikanbuku-bukuyangrelevan kepadasiswauntukdipelajari secaraterus-menerus.Pembelajarandenganteori ini,mengakselerasi siswauntukselalumeningkatkankemampuannyadanketrampilannyadengansenantiasabelajar setiaphari,mempelajari materi-materi setiaphari,sehinggasemuakompetensi yangdistandarkan dapat dikuasai.
  42. 42. Standar kompetesibahankajianPengetahuanSosial danIlmu-IlmuSosial danKewarganegaraan (Arnie Fajar,2009: 105), adalah: 1. Kemampuanmemahami fakta,konsep,dangeneralisasi tentangsistemsosial danbudayadan menerapkannyauntuk: a. Mengembangkansikapkritisdalamsituasi sosial yangtimbul sebagai akibatperbedaanyangada di masyarakat; b. Menentukansikapterhadapprosesperkembangandanperubahansosial budaya; c. Menghargai keanekaragamansosial budayadalammasyarakatmultikultural. 2. Kemampuanmemahami fakta,konsep,dangeneralisasi tentangmanusia,tempatdanlingkungan sertamenerapkannyauntuk: a. Meganalisisproseskejadian,interaksidansalingketergantunganantaragejalaalamdan kehidupandi mukabumi dalamdimensiruangdanwaktu; b. Terampil dalammemperoleh,mengolahdanmenyajikaninformasigeografis. 3. Kemampuanmemahami fakta,konsep,dangeneralisasi tentangperilakuekonomda kesejahteraansertamenerapkanyauntuk: a. Berperilakuyangrasional danmanusiawi dalammemanfaatkansumberdayaekonomi; b. Menumbuhkanjiwa,sikapdanperilakukewirausahaa; c. Menganalisissisteminformasi keuanganlembaga-lembagaekonomi;
  43. 43. d. Terampil dalampraktikusahaekonomi sendiri. 4. Kemampuanmemahami fakta,konsep,dangeneralisasi tentang waktu,keberlanjutadan perubahansertamenerapkannyauntuk: a. Meganalisisketerkaitanantaramanusia,waktu,tempat,dankejadian; b. Merekonstruksi masalalu,memaknai masakini,danmemprediksi masadepan; c. Menghargai berbagai perbedaanserta keragamansosial,kultural,agama,etnisdanpolitikdalam masyarakatdari pengalamanbelajarperistiwasejarah. 5. Kemampuanmemahami danmeninternalisasi sistemberbansadanbernegaraserta menerapkannyauntuk: a. MewujudkanpersatuanbangsaberdasarkanPancasiladanUndang-Undang1945; b. Membiasakanuntukmematuhi norma,menegakkanhukum, danmenjalankanperaturan; c. Berpartisipasi dalammewujudkanmasyarakatdanpemerintahanyangdemokratis;menjunjung tinggi,melaksanakandanmenghargai HAM. Berdasarkankarakteristikpembelajaranilmu-ilmusosialdankewarganegaraantersebuttentusaja teori disiplinmental sangatdominandipergunakandalampembelajaranterutamapermasalahan pengetahuantentangmasalahkonsep-konsep.Pengertian,definisi,kriteriadanmateri-materi pembelajaranyangperludikuasai tentusajadiperlukanpenerapanteori disiplinmental dalam prosespembelajarannya. Penerapansecaranyatadalamprosesbelajarmengajaryangberhubungandengandisiplinmental dalamsetiapmata pelajaran(misalnyapembelajarantingkatSMP) sebagai berikut:
  44. 44. 1. PembelajaranEkonomi Guru memberikanmateri pembelajarantentangsistemperilakuekonomi dankesejahteraandengan memberikanpengertiantentangsistemberekonomi,ketergantungan,sesialisasi danpemberian kerja,perkoperasian,kewirausahaan,danpengelolaankeuanganperusahaan.Materi-materi tersebutdapatdisampaikansiswadenganmenerangkanataumengunakanbukudandiakhir pembelajaransiswamengerjakanLKSsebagai teshasil evaluasi. 2. PembelajaranSejarah Guru dapat menggunakangambardanmedialaindenganmemberikanmateri tentangdasar-dasar ilmusejarah,fakta,peristiwadanprosessejarah.Siswadiakhirpembelajarandimintauntuk menerangkankembali tentangpembelajantersebut agarlebihmemperdalammateri pembelajaran bagi siswalainnya. 3. PembelajaranGeografi Guru dapat menggunakanpetadandiskusi tentangmateri sisteminformasigeografi,interaksi gejala fisikdansosial,strukturinternal suatutemat,interaksi keruangandanpersepsi lingkungandan kewilayahan.Gurudapatmemberikantugasdenganmempelajari materi lainuntukmemerdalam materi. 4. PembelajaranPKn Guru dapat mengunakanstrategi belajarkelompok,untukmembahastentangpersatuanbangsa, nilai dannorma,hak asasi mausia,kebutuhanhidup,kekuasaandanpolitik,masyarakatdemokratis, Pancasiladakonstitusi negarasertaglobalisasi.Gurukemudiandapatbertanyakepadasiswasatu persatuuntukmenjawabpertanyaadari guruuntukmengukurkedalamanpemahama materi. Teori disiplinmental jugadapatdilaksanakandenganmenggunakanpembelajarandenganstrategi eksositori.Model pengajaranekspositori merupakankegiatanyangterpusatpadaguru.Guru aktif membeerikanpenjelasanatauinformasi tererinci tentang bahanpengajaran.Tujuanutama pengajaranekspositori adalahmemindahkanpengetahuan,ketrampiladanilai-nilaikepadasiswa.
  45. 45. Hal yangesensial padabahanpengajaranharusdijelaskankepadasiswa(Dimyati danMudjiono, 2006: 172). Referensi http://makalahmu.wordpress.com/2010/11/04/implementasi-teori-belajar-disiplin-mental-dalam- pembelajaran-ips/ http://elearning.unesa.ac.id/tag/buku-refernsi-dasar-teori-ips http://halimsani.wordpress.com/2007/09/06/teori-teori-sosial-dari-ilmu-sosial-sekuleristik-menuju- ilmu-sosial-intergralistik/ http://muchad.com/teori-ilmu-sosial-hakikat-tujuan-ilmu-sosial-dasar.html http://id.wikipedia.org/wiki/Ilmu_Sosial_Profetik Ada 7 asumsi dasar : 1. Bahwa masyarakatyang analisissebagai suatukesukuanyangterdiri dari berbagai yangsaling berintegrasi. 2. Hubunganyang ada bisabersifatsatuarah atau juga bisabersifathubungantimbal balik. 3. Systemsosial yangada bersifatdinamis. 4. Integrasi yangsempurnadimasyarakattidakpernahada,olehkarenanyaseringtimbul ketegangan-ketegangandanpenyimpangan-penyimpanganakhirtetapi dapattdinetralisirlewat prosespelembagaan. 5. Perubahan-perubahanakanberjalansecarabiladualdanperlahan-lahansebagai suatuproses pembuatan. 6. Perubahanadalahmerupakanpenyesuaiandanyangtumbuhkarenaadanyadifferensiasi dan inovasi. 7. Bahwa systemdiintegrasikanlewatpendidikandengannilai-nilai yangsama Sumber:http://id.shvoong.com/writing-and-speaking/2144438-asumsi-dasar-dalam-teori- teori/#ixzz1qNa9RAPr http://dire-laverite.blogspot.com/2012/03/teori-teori-belajar-dan-penerapannya.html

TKS

Vistos

Vistos totais

5

No Slideshare

0

De incorporações

0

Número de incorporações

0

Ações

Baixados

0

Compartilhados

0

Comentários

0

Curtir

0

×