SlideShare uma empresa Scribd logo
1 de 30
Development of Biomarkers for Stress in Octopus Rachel Thompson School of Aquatic and Fishery Sciences May 15, 2009
Background ,[object Object],[object Object],[object Object],[object Object],Giant Pacific Octopus ( E. dofleini ) Red Octopus ( O. rubescens )
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Non-Invasive Techniques ,[object Object],[object Object],[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Protein Gel Electrophoresis ,[object Object],[object Object],[object Object],[object Object],Container Underwater Skin
Protein Identification ,[object Object],[object Object]
Mass Spectroscopy ,[object Object],[object Object],[object Object],Description Sequence (P02662) Alpha-S1-casein precursor YLGYLEQ (P02662) Alpha-S1-casein precursor EPMIGVNQELAYFYPELFR (P02808) Statherin precursor RIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF (P81605) Dermicidin precursor [Contains: Survival-promoting peptide; DCD-1] DAVEDLESVGK
Proteins Isolated from Mucus ,[object Object],[object Object],[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Heat Shock Proteins ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Western Blot - HSP 70 ,[object Object],[object Object],[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object]
Behavior Monitoring   ,[object Object],[object Object],[object Object],Cephcam watch ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Behavior Observations ,[object Object],[object Object]
Objectives ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Egg Development Laid January, 2009 Refrain from imposing stressful conditions
Observation of Developmental Stages Early: 8 weeks
Late: 12 weeks - Appearance of  chromatophores - Movement within egg
 
Egg Development ,[object Object],[object Object],[object Object],[object Object]
Developmental Genes ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Real-Time PCR (qPCR) ,[object Object],[object Object],[object Object]
Orthodenticle-like protein (OTX) -Expressed early in development  -100,000 fold increase over time
Hedgehog (Hh) -Expressed later in development <100 fold increase over time
Results-Gene Expression ,[object Object],[object Object],[object Object],[object Object],[object Object]
Behavior Observations Prior to Egg-Laying Post Egg-Laying
Summary ,[object Object],[object Object],[object Object],[object Object]
Applications and Future Work ,[object Object],[object Object],[object Object]
Acknowledgements ,[object Object],[object Object],[object Object],[object Object]

Mais conteúdo relacionado

Mais procurados

13 4 applications of genetic engineering
13 4 applications of genetic engineering13 4 applications of genetic engineering
13 4 applications of genetic engineeringarislantern
 
Genetics By Swati & Sheela
Genetics By Swati & SheelaGenetics By Swati & Sheela
Genetics By Swati & Sheelasubzero64
 
Transgenic animal prof.a.k.saha
Transgenic animal prof.a.k.sahaTransgenic animal prof.a.k.saha
Transgenic animal prof.a.k.sahaAnanda Saha
 
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...Larry Smarr
 
Cross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
Cross-Kingdom Standards in Genomics, Epigenomics and MetagenomicsCross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
Cross-Kingdom Standards in Genomics, Epigenomics and Metagenomics Christopher Mason
 
2 chapter 5 genes and chromosome
2 chapter 5   genes and chromosome2 chapter 5   genes and chromosome
2 chapter 5 genes and chromosomea alice
 
Epigenetic and Environmental Influences on the Shellfish Immune Response
Epigenetic and Environmental Influences on the Shellfish Immune ResponseEpigenetic and Environmental Influences on the Shellfish Immune Response
Epigenetic and Environmental Influences on the Shellfish Immune Responsesr320
 
Transgenic animal models &amp; their
Transgenic animal models &amp; theirTransgenic animal models &amp; their
Transgenic animal models &amp; theirkalpanatiwari17
 
Genetic Engineering Powerpoint
Genetic Engineering PowerpointGenetic Engineering Powerpoint
Genetic Engineering PowerpointMrG
 
Genetic engineering oral
Genetic engineering oralGenetic engineering oral
Genetic engineering oralDamien512
 
Genetic engineering in animal
Genetic engineering in animalGenetic engineering in animal
Genetic engineering in animalTaikiat Kiat
 
Genetic engineerig
Genetic engineerigGenetic engineerig
Genetic engineerigUsman Arshad
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic Engineeringguestb995763
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic EngineeringDamien512
 
Biotechnology and1 genetic engineering
Biotechnology and1 genetic engineeringBiotechnology and1 genetic engineering
Biotechnology and1 genetic engineeringmandalina landy
 
Nanopore long-read metagenomics
Nanopore long-read metagenomicsNanopore long-read metagenomics
Nanopore long-read metagenomicsMartin Hölzer
 

Mais procurados (20)

13 4 applications of genetic engineering
13 4 applications of genetic engineering13 4 applications of genetic engineering
13 4 applications of genetic engineering
 
Genetics By Swati & Sheela
Genetics By Swati & SheelaGenetics By Swati & Sheela
Genetics By Swati & Sheela
 
Genetic Engineering ppt
Genetic Engineering pptGenetic Engineering ppt
Genetic Engineering ppt
 
Transgenic animal prof.a.k.saha
Transgenic animal prof.a.k.sahaTransgenic animal prof.a.k.saha
Transgenic animal prof.a.k.saha
 
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
Building a Community Cyberinfrastructure to Support Marine Microbial Ecology ...
 
Cross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
Cross-Kingdom Standards in Genomics, Epigenomics and MetagenomicsCross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
Cross-Kingdom Standards in Genomics, Epigenomics and Metagenomics
 
2 chapter 5 genes and chromosome
2 chapter 5   genes and chromosome2 chapter 5   genes and chromosome
2 chapter 5 genes and chromosome
 
Epigenetic and Environmental Influences on the Shellfish Immune Response
Epigenetic and Environmental Influences on the Shellfish Immune ResponseEpigenetic and Environmental Influences on the Shellfish Immune Response
Epigenetic and Environmental Influences on the Shellfish Immune Response
 
Future of technology
Future of technologyFuture of technology
Future of technology
 
Transgenic animal models &amp; their
Transgenic animal models &amp; theirTransgenic animal models &amp; their
Transgenic animal models &amp; their
 
Genetic Engineering Powerpoint
Genetic Engineering PowerpointGenetic Engineering Powerpoint
Genetic Engineering Powerpoint
 
Genetic engineering oral
Genetic engineering oralGenetic engineering oral
Genetic engineering oral
 
Transgenic animals
Transgenic animalsTransgenic animals
Transgenic animals
 
Genetic engineering in animal
Genetic engineering in animalGenetic engineering in animal
Genetic engineering in animal
 
Genetic engineerig
Genetic engineerigGenetic engineerig
Genetic engineerig
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic Engineering
 
Transgenic Talk
Transgenic TalkTransgenic Talk
Transgenic Talk
 
Genetic Engineering
Genetic EngineeringGenetic Engineering
Genetic Engineering
 
Biotechnology and1 genetic engineering
Biotechnology and1 genetic engineeringBiotechnology and1 genetic engineering
Biotechnology and1 genetic engineering
 
Nanopore long-read metagenomics
Nanopore long-read metagenomicsNanopore long-read metagenomics
Nanopore long-read metagenomics
 

Semelhante a Thompson_MGpresentation

Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011 Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011 changingconnections
 
Rebecca Pentecost DVM: PLAA 2011 Keynote Slides
Rebecca Pentecost DVM: PLAA 2011 Keynote SlidesRebecca Pentecost DVM: PLAA 2011 Keynote Slides
Rebecca Pentecost DVM: PLAA 2011 Keynote SlidesRJ Stangherlin
 
General biology-2-module-1-answers
General biology-2-module-1-answersGeneral biology-2-module-1-answers
General biology-2-module-1-answersSherylOsorio
 
Jonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship ApplicationJonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship ApplicationJon Lendrum
 
screening model for Parkinson's disease.pptx
screening model for Parkinson's disease.pptxscreening model for Parkinson's disease.pptx
screening model for Parkinson's disease.pptxAHEMANTHBABU
 
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat:  Understanding Continuous, Real Time Physiologic MonitoringDon't Miss a Beat:  Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic MonitoringInsideScientific
 
Lecture 1 Introduction to Bioinformatics BCH 433.ppt
Lecture 1 Introduction to Bioinformatics BCH 433.pptLecture 1 Introduction to Bioinformatics BCH 433.ppt
Lecture 1 Introduction to Bioinformatics BCH 433.pptKelechiChukwuemeka
 
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...Healthcare and Medical Sciences
 
Genetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosisGenetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosisTijani Hamzat Ibiyeye
 

Semelhante a Thompson_MGpresentation (20)

Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011 Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
Dr. Rebecca Pentecost: Pennsylvania Llama and Alpaca Association 2011
 
Rebecca Pentecost DVM: PLAA 2011 Keynote Slides
Rebecca Pentecost DVM: PLAA 2011 Keynote SlidesRebecca Pentecost DVM: PLAA 2011 Keynote Slides
Rebecca Pentecost DVM: PLAA 2011 Keynote Slides
 
General biology-2-module-1-answers
General biology-2-module-1-answersGeneral biology-2-module-1-answers
General biology-2-module-1-answers
 
Host Cell Proteins
Host Cell ProteinsHost Cell Proteins
Host Cell Proteins
 
Host Cell Proteins
Host Cell ProteinsHost Cell Proteins
Host Cell Proteins
 
Jonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship ApplicationJonathan Lendrum, Dean's Distinguished Research Fellowship Application
Jonathan Lendrum, Dean's Distinguished Research Fellowship Application
 
Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...
Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...
Neurons in the Medulla Oblongata Related to Gastric Mucosal Lesion of Rats Su...
 
screening model for Parkinson's disease.pptx
screening model for Parkinson's disease.pptxscreening model for Parkinson's disease.pptx
screening model for Parkinson's disease.pptx
 
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat:  Understanding Continuous, Real Time Physiologic MonitoringDon't Miss a Beat:  Understanding Continuous, Real Time Physiologic Monitoring
Don't Miss a Beat: Understanding Continuous, Real Time Physiologic Monitoring
 
Lecture 1 Introduction to Bioinformatics BCH 433.ppt
Lecture 1 Introduction to Bioinformatics BCH 433.pptLecture 1 Introduction to Bioinformatics BCH 433.ppt
Lecture 1 Introduction to Bioinformatics BCH 433.ppt
 
Poster
PosterPoster
Poster
 
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
High-throughput Sequencing Analysis and Function Prediction of Lung Microbiot...
 
Genetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosisGenetic proclivities of two-component modulated aerobiosis
Genetic proclivities of two-component modulated aerobiosis
 
Biotechnology.pptx
Biotechnology.pptxBiotechnology.pptx
Biotechnology.pptx
 
Galvao MOL et al 2009
Galvao MOL et al 2009Galvao MOL et al 2009
Galvao MOL et al 2009
 
Galvao MOL et al 2009
Galvao MOL et al 2009Galvao MOL et al 2009
Galvao MOL et al 2009
 
Npy
NpyNpy
Npy
 
Npy final paper
Npy final paperNpy final paper
Npy final paper
 
Npy final paper
Npy final paperNpy final paper
Npy final paper
 
Varney_2015
Varney_2015Varney_2015
Varney_2015
 

Mais de sr320

Identifying Local Olympia Oyster Stocks Useful for Restoration
Identifying Local Olympia Oyster Stocks Useful for RestorationIdentifying Local Olympia Oyster Stocks Useful for Restoration
Identifying Local Olympia Oyster Stocks Useful for Restorationsr320
 
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?sr320
 
Science Communication and Impact: A Researcher's Perspective
Science Communication and Impact: A Researcher's PerspectiveScience Communication and Impact: A Researcher's Perspective
Science Communication and Impact: A Researcher's Perspectivesr320
 
Genomic approaches to assessing ecosystem health
Genomic approaches to assessing ecosystem healthGenomic approaches to assessing ecosystem health
Genomic approaches to assessing ecosystem healthsr320
 
Collaborative Genomic Data Analyses in the Cloud
Collaborative Genomic Data Analyses in the CloudCollaborative Genomic Data Analyses in the Cloud
Collaborative Genomic Data Analyses in the Cloudsr320
 
Genomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more OpenGenomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more Opensr320
 
NSA2012 Short reads and Oyster Genome Resources
NSA2012 Short reads and Oyster Genome ResourcesNSA2012 Short reads and Oyster Genome Resources
NSA2012 Short reads and Oyster Genome Resourcessr320
 
Short read sequencing and shellfish
Short read sequencing and shellfishShort read sequencing and shellfish
Short read sequencing and shellfishsr320
 
FISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylationFISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylationsr320
 
FISH441: Oyster acidification: gene and protein expression
FISH441: Oyster acidification: gene and protein expression FISH441: Oyster acidification: gene and protein expression
FISH441: Oyster acidification: gene and protein expression sr320
 
FISH441: Oyster Hypoxia and acclimation
FISH441: Oyster Hypoxia and acclimationFISH441: Oyster Hypoxia and acclimation
FISH441: Oyster Hypoxia and acclimationsr320
 
Timmins Schiffman PCSGA 2011
Timmins Schiffman PCSGA 2011Timmins Schiffman PCSGA 2011
Timmins Schiffman PCSGA 2011sr320
 
Elene Dorfmeier pcsga11
Elene Dorfmeier pcsga11 Elene Dorfmeier pcsga11
Elene Dorfmeier pcsga11 sr320
 
FISH510 Lec 1
FISH510 Lec 1FISH510 Lec 1
FISH510 Lec 1sr320
 
FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)sr320
 
Timmins-Schiffman P2010
Timmins-Schiffman P2010Timmins-Schiffman P2010
Timmins-Schiffman P2010sr320
 
Gavery PCSGA 2010
Gavery PCSGA 2010Gavery PCSGA 2010
Gavery PCSGA 2010sr320
 
Salmon Senescence
Salmon SenescenceSalmon Senescence
Salmon Senescencesr320
 
Roberts GRC
Roberts GRCRoberts GRC
Roberts GRCsr320
 
Herring SNP Sneak Peak
Herring SNP Sneak PeakHerring SNP Sneak Peak
Herring SNP Sneak Peaksr320
 

Mais de sr320 (20)

Identifying Local Olympia Oyster Stocks Useful for Restoration
Identifying Local Olympia Oyster Stocks Useful for RestorationIdentifying Local Olympia Oyster Stocks Useful for Restoration
Identifying Local Olympia Oyster Stocks Useful for Restoration
 
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
Does DNA methylation facilitate phenotypic plasticity in marine invertebrates?
 
Science Communication and Impact: A Researcher's Perspective
Science Communication and Impact: A Researcher's PerspectiveScience Communication and Impact: A Researcher's Perspective
Science Communication and Impact: A Researcher's Perspective
 
Genomic approaches to assessing ecosystem health
Genomic approaches to assessing ecosystem healthGenomic approaches to assessing ecosystem health
Genomic approaches to assessing ecosystem health
 
Collaborative Genomic Data Analyses in the Cloud
Collaborative Genomic Data Analyses in the CloudCollaborative Genomic Data Analyses in the Cloud
Collaborative Genomic Data Analyses in the Cloud
 
Genomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more OpenGenomics on the Half Shell: Making Science more Open
Genomics on the Half Shell: Making Science more Open
 
NSA2012 Short reads and Oyster Genome Resources
NSA2012 Short reads and Oyster Genome ResourcesNSA2012 Short reads and Oyster Genome Resources
NSA2012 Short reads and Oyster Genome Resources
 
Short read sequencing and shellfish
Short read sequencing and shellfishShort read sequencing and shellfish
Short read sequencing and shellfish
 
FISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylationFISH441: Oysters, acidification and methylation
FISH441: Oysters, acidification and methylation
 
FISH441: Oyster acidification: gene and protein expression
FISH441: Oyster acidification: gene and protein expression FISH441: Oyster acidification: gene and protein expression
FISH441: Oyster acidification: gene and protein expression
 
FISH441: Oyster Hypoxia and acclimation
FISH441: Oyster Hypoxia and acclimationFISH441: Oyster Hypoxia and acclimation
FISH441: Oyster Hypoxia and acclimation
 
Timmins Schiffman PCSGA 2011
Timmins Schiffman PCSGA 2011Timmins Schiffman PCSGA 2011
Timmins Schiffman PCSGA 2011
 
Elene Dorfmeier pcsga11
Elene Dorfmeier pcsga11 Elene Dorfmeier pcsga11
Elene Dorfmeier pcsga11
 
FISH510 Lec 1
FISH510 Lec 1FISH510 Lec 1
FISH510 Lec 1
 
FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)FISH441 Group Project (Oysters)
FISH441 Group Project (Oysters)
 
Timmins-Schiffman P2010
Timmins-Schiffman P2010Timmins-Schiffman P2010
Timmins-Schiffman P2010
 
Gavery PCSGA 2010
Gavery PCSGA 2010Gavery PCSGA 2010
Gavery PCSGA 2010
 
Salmon Senescence
Salmon SenescenceSalmon Senescence
Salmon Senescence
 
Roberts GRC
Roberts GRCRoberts GRC
Roberts GRC
 
Herring SNP Sneak Peak
Herring SNP Sneak PeakHerring SNP Sneak Peak
Herring SNP Sneak Peak
 

Último

COMMUNICATING NEGATIVE NEWS - APPROACHES .pptx
COMMUNICATING NEGATIVE NEWS - APPROACHES .pptxCOMMUNICATING NEGATIVE NEWS - APPROACHES .pptx
COMMUNICATING NEGATIVE NEWS - APPROACHES .pptxannathomasp01
 
SOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning PresentationSOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning Presentationcamerronhm
 
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...Pooja Bhuva
 
Basic Intentional Injuries Health Education
Basic Intentional Injuries Health EducationBasic Intentional Injuries Health Education
Basic Intentional Injuries Health EducationNeilDeclaro1
 
The basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxThe basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxheathfieldcps1
 
Jamworks pilot and AI at Jisc (20/03/2024)
Jamworks pilot and AI at Jisc (20/03/2024)Jamworks pilot and AI at Jisc (20/03/2024)
Jamworks pilot and AI at Jisc (20/03/2024)Jisc
 
REMIFENTANIL: An Ultra short acting opioid.pptx
REMIFENTANIL: An Ultra short acting opioid.pptxREMIFENTANIL: An Ultra short acting opioid.pptx
REMIFENTANIL: An Ultra short acting opioid.pptxDr. Ravikiran H M Gowda
 
FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024Elizabeth Walsh
 
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfUGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfNirmal Dwivedi
 
Food safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfFood safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfSherif Taha
 
How to setup Pycharm environment for Odoo 17.pptx
How to setup Pycharm environment for Odoo 17.pptxHow to setup Pycharm environment for Odoo 17.pptx
How to setup Pycharm environment for Odoo 17.pptxCeline George
 
ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.MaryamAhmad92
 
Single or Multiple melodic lines structure
Single or Multiple melodic lines structureSingle or Multiple melodic lines structure
Single or Multiple melodic lines structuredhanjurrannsibayan2
 
Towards a code of practice for AI in AT.pptx
Towards a code of practice for AI in AT.pptxTowards a code of practice for AI in AT.pptx
Towards a code of practice for AI in AT.pptxJisc
 
Understanding Accommodations and Modifications
Understanding  Accommodations and ModificationsUnderstanding  Accommodations and Modifications
Understanding Accommodations and ModificationsMJDuyan
 
21st_Century_Skills_Framework_Final_Presentation_2.pptx
21st_Century_Skills_Framework_Final_Presentation_2.pptx21st_Century_Skills_Framework_Final_Presentation_2.pptx
21st_Century_Skills_Framework_Final_Presentation_2.pptxJoelynRubio1
 
How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17Celine George
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxDenish Jangid
 
ICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxAreebaZafar22
 

Último (20)

COMMUNICATING NEGATIVE NEWS - APPROACHES .pptx
COMMUNICATING NEGATIVE NEWS - APPROACHES .pptxCOMMUNICATING NEGATIVE NEWS - APPROACHES .pptx
COMMUNICATING NEGATIVE NEWS - APPROACHES .pptx
 
SOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning PresentationSOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning Presentation
 
Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024
 
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...
 
Basic Intentional Injuries Health Education
Basic Intentional Injuries Health EducationBasic Intentional Injuries Health Education
Basic Intentional Injuries Health Education
 
The basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxThe basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptx
 
Jamworks pilot and AI at Jisc (20/03/2024)
Jamworks pilot and AI at Jisc (20/03/2024)Jamworks pilot and AI at Jisc (20/03/2024)
Jamworks pilot and AI at Jisc (20/03/2024)
 
REMIFENTANIL: An Ultra short acting opioid.pptx
REMIFENTANIL: An Ultra short acting opioid.pptxREMIFENTANIL: An Ultra short acting opioid.pptx
REMIFENTANIL: An Ultra short acting opioid.pptx
 
FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024
 
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdfUGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
UGC NET Paper 1 Mathematical Reasoning & Aptitude.pdf
 
Food safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdfFood safety_Challenges food safety laboratories_.pdf
Food safety_Challenges food safety laboratories_.pdf
 
How to setup Pycharm environment for Odoo 17.pptx
How to setup Pycharm environment for Odoo 17.pptxHow to setup Pycharm environment for Odoo 17.pptx
How to setup Pycharm environment for Odoo 17.pptx
 
ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.
 
Single or Multiple melodic lines structure
Single or Multiple melodic lines structureSingle or Multiple melodic lines structure
Single or Multiple melodic lines structure
 
Towards a code of practice for AI in AT.pptx
Towards a code of practice for AI in AT.pptxTowards a code of practice for AI in AT.pptx
Towards a code of practice for AI in AT.pptx
 
Understanding Accommodations and Modifications
Understanding  Accommodations and ModificationsUnderstanding  Accommodations and Modifications
Understanding Accommodations and Modifications
 
21st_Century_Skills_Framework_Final_Presentation_2.pptx
21st_Century_Skills_Framework_Final_Presentation_2.pptx21st_Century_Skills_Framework_Final_Presentation_2.pptx
21st_Century_Skills_Framework_Final_Presentation_2.pptx
 
How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17How to Add New Custom Addons Path in Odoo 17
How to Add New Custom Addons Path in Odoo 17
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
 
ICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptx
 

Thompson_MGpresentation