SlideShare uma empresa Scribd logo
1 de 38
Baixar para ler offline
Cloning, Expression, Purification and
Enzymological Characterization of
NS2B(H)/NS3 protease of
Japanese Encephalitis Virus.
 Chakard Chalayut
 Advisor: Assit. Prof. Gerd Katzenmier

Laboratory of Molecular Virology
Institute of Molecular Biology & Genetics

                                            1
Japanese Encephalitis Virus
             Flaviviridae family
Dengue (Den)

West nile virus (WNV)
Yellow fever virus (YFV)

Japanese Encephalitis Virus (JEV)

ETC...


                                    2
Japanese Encephalitis Virus
             Flaviviridae family
Dengue (Den)

West nile virus (WNV)
Yellow fever virus (YFV)

Japanese Encephalitis Virus (JEV)

ETC...


                                    2
Japanese Encephalitis Virus
Mosquito-borne neurotropic flavivirus
  causes severe central nerve system diseases
Divided into 4 Genotypes.
For unknown reason genotypes 3 is the most outbreak.
Culex tritaeniorhynchus is the important vector.




              http://www.fehd.gov.hk

                                                       3
Japanese Encephalitis Virus




       http://www.fehd.gov.hk

                                3
Japanese Encephalitis Virus




                              4
Japanese Encephalitis Virus

J E V c a u s e s s e v e re
central nerve system
diseases such as
poliomyelitis- like acute
flaccid paralysis, aseptic
m e n i n g i t i s a n d http://www.wonder.cdc.gov
encephalitis




                                                      4
Japanese Encephalitis Virus




        http://www.cdc.gov

                              4
Japanese Encephalitis Virus



 50,000 cases/year



                              4
Japanese Encephalitis Virus



10,000 Death Cases/year



                              4
Japanese Encephalitis Virus



  30% fatality rate


                              4
Prevention and treatment of
JEV disease




                              5
Prevention and treatment of
JEV disease
     Drug




                              5
Prevention and treatment of
JEV disease
       Drug           No drug exist

Vaccine development




                                      5
Prevention and treatment of
JEV disease
       Drug            No drug exist

Vaccine development   Available vaccine

 Mosquitoes control




                                          5
Prevention and treatment of
JEV disease
       Drug            No drug exist

Vaccine development   Available vaccine

 Mosquitoes control    Elimination of
                        mosquitoes
                      breeding places


                                          5
Molecular biology of
Japanese Encephalitis Virus




                 www. molecular-virology.uni-hd.de
                                                6
Molecular biology of
Japanese Encephalitis Virus




                 www. molecular-virology.uni-hd.de
                                                6
Molecular biology of
Japanese Encephalitis Virus




                 www. molecular-virology.uni-hd.de
                                                6
Molecular biology of
Japanese Encephalitis Virus




                 www. molecular-virology.uni-hd.de
                                                6
The NS2B
 130 aa
  activating domain central hydrophilic region
 (Falgout et al, 1993)
 3 membrane spanning parts




                                                 7
The NS2B
 130 aa
  activating domain central hydrophilic region
 (Falgout et al, 1993)
 3 membrane spanning parts        Hypothetical model
                                  NS2B-NS3 complex




                                                       7
The NS2B
 130 aa
  activating domain central hydrophilic region
 (Falgout et al, 1993)
 3 membrane spanning parts        Hypothetical model
                                  NS2B-NS3 complex




                                                       7
The NS2B


                         Hypothetical model
                         NS2B-NS3 complex




Brinkworth et al, 1999
                                              7
The NS2B


                                    Hypothetical model
                                    NS2B-NS3 complex




  58 VSGKATDMWLERAADISWEMDAAITGSSRRLDVKLDDDGDFHLIDDPGVP 101
Brinkworth et al, 1999
                                                              7
The NS3




 Theoretical model from PDB
             2I84
                              8
The NS3
                              Protease




 Theoretical model from PDB
             2I84
                                         8
The NS3
                              Protease

                                NTPase




 Theoretical model from PDB
             2I84
                                         8
The NS3
                              Protease

                                 NTPase




                              RNA Helicase


 Theoretical model from PDB
             2I84
                                             8
The NS3




       Chymotrypsin-like fold
        2-β barrel domains
          Inactive alone
      Enzyme’s pocket is small
                                 8
The NS3 protease




                   9
The NS3 protease
    Complexation with NS2B cofactor




                   conformational change
                   alteration of the enzyme
                   pocket additional substrate
                   binding site


                                                 9
The NS3 protease

            NS3 serine protease
            domain 20 kDa
            catalytic residues His51,
            Asp75, Ser135




                                        9
Lin. C W et al,2007
                      10
Ser46 to Ile60 were essential region required for NS3
protease activity.
Ala substition of Trp50, Glu55, and Arg56 in NS2B shown
significantly reduced NS3 protease activity.




                                    Lin. C W et al,2007
                                                          10
Compare to the structure



JEV                                   WNV




JEV homology model from Den   Den 2
                                            11
Report

From Novartis
  Den 2 protease can be activated by Den1,2,3 ,WNV
  and YFV NS2B(H)
From Jan L.R. et al 1995
  Den 4 protease can’t be activated by JEV NS2B(H)
  but JEV protease can activated by Den 4 NS2B(H)




                                                     12
From the different on NS2B(H)-NS3 protease complex
structure and cofactor specificity.Can we do the NS2B
cofactor analog as an universal drug for flavivirus?




                                                       13

Mais conteúdo relacionado

Mais procurados

appliedscience_MaasBP_vj14_280441
appliedscience_MaasBP_vj14_280441appliedscience_MaasBP_vj14_280441
appliedscience_MaasBP_vj14_280441
Benjamin Maas
 
Presentation_defense_final_3
Presentation_defense_final_3Presentation_defense_final_3
Presentation_defense_final_3
Ksenia Yakhontova
 
CRISPR: Opportunities and Challenges Webinar
CRISPR: Opportunities and Challenges WebinarCRISPR: Opportunities and Challenges Webinar
CRISPR: Opportunities and Challenges Webinar
PreScouter
 

Mais procurados (20)

PNAS-2015-Messer
PNAS-2015-MesserPNAS-2015-Messer
PNAS-2015-Messer
 
Jason_poster_3
Jason_poster_3Jason_poster_3
Jason_poster_3
 
polarized macrophages in choroidal neovascularization
polarized macrophages in choroidal neovascularizationpolarized macrophages in choroidal neovascularization
polarized macrophages in choroidal neovascularization
 
The effect of nano curcumin on nuclear
The effect of nano curcumin on nuclearThe effect of nano curcumin on nuclear
The effect of nano curcumin on nuclear
 
appliedscience_MaasBP_vj14_280441
appliedscience_MaasBP_vj14_280441appliedscience_MaasBP_vj14_280441
appliedscience_MaasBP_vj14_280441
 
Brittany BU STARS Abstract
Brittany BU STARS AbstractBrittany BU STARS Abstract
Brittany BU STARS Abstract
 
Next Generation Sequencing - Prof. Frans Cremers
Next Generation Sequencing - Prof. Frans CremersNext Generation Sequencing - Prof. Frans Cremers
Next Generation Sequencing - Prof. Frans Cremers
 
Next Generation Sequencing for Joubert Poster
Next Generation Sequencing for Joubert PosterNext Generation Sequencing for Joubert Poster
Next Generation Sequencing for Joubert Poster
 
Next Generation Sequencing for Joubert Syndrome
Next Generation Sequencing for Joubert SyndromeNext Generation Sequencing for Joubert Syndrome
Next Generation Sequencing for Joubert Syndrome
 
Presentation_defense_final_3
Presentation_defense_final_3Presentation_defense_final_3
Presentation_defense_final_3
 
Virology antibodies- Life cycle of West Nile Virus
Virology antibodies- Life cycle of West Nile VirusVirology antibodies- Life cycle of West Nile Virus
Virology antibodies- Life cycle of West Nile Virus
 
Strijp Linkedin
Strijp LinkedinStrijp Linkedin
Strijp Linkedin
 
Presentacion seminario
Presentacion seminario Presentacion seminario
Presentacion seminario
 
SARS-CoV-2 and Covid-19: Genetics, Treatment and Vaccines
SARS-CoV-2 and Covid-19: Genetics, Treatment and VaccinesSARS-CoV-2 and Covid-19: Genetics, Treatment and Vaccines
SARS-CoV-2 and Covid-19: Genetics, Treatment and Vaccines
 
Crispr-cas9 food editing (genetic)
Crispr-cas9 food editing (genetic)Crispr-cas9 food editing (genetic)
Crispr-cas9 food editing (genetic)
 
Cancer
Cancer Cancer
Cancer
 
Short hairpin rna
Short hairpin rnaShort hairpin rna
Short hairpin rna
 
CRISPR: Opportunities and Challenges Webinar
CRISPR: Opportunities and Challenges WebinarCRISPR: Opportunities and Challenges Webinar
CRISPR: Opportunities and Challenges Webinar
 
P27_BEKAERT (1)
P27_BEKAERT (1)P27_BEKAERT (1)
P27_BEKAERT (1)
 
DNA
DNA DNA
DNA
 

Semelhante a Flavivirus Group meeting

Cer cor11 franco-cercor-bhr199
Cer cor11 franco-cercor-bhr199Cer cor11 franco-cercor-bhr199
Cer cor11 franco-cercor-bhr199
shiraknafo
 
Presentación plegable1
Presentación plegable1Presentación plegable1
Presentación plegable1
Leslie M.
 
Presentación plegable 1
Presentación plegable 1Presentación plegable 1
Presentación plegable 1
Leslie M.
 
Presentación plegable1
Presentación plegable1Presentación plegable1
Presentación plegable1
Leslie M.
 
Vector delivery
Vector deliveryVector delivery
Vector delivery
zwiegers
 
Neuromyelitis optica pathogenesis and aquaporin 4
Neuromyelitis optica pathogenesis and aquaporin 4Neuromyelitis optica pathogenesis and aquaporin 4
Neuromyelitis optica pathogenesis and aquaporin 4
Ana Arata
 
Machula Thesis Proposal
Machula Thesis ProposalMachula Thesis Proposal
Machula Thesis Proposal
Jason Machula
 
Structure and function of dna
Structure and function of dnaStructure and function of dna
Structure and function of dna
UsmanShahzad1977
 
Statistical methods for microarray data analysis
Statistical methods for microarray data analysisStatistical methods for microarray data analysis
Statistical methods for microarray data analysis
Springer
 
Statistical methods for microarray data analysis
Statistical methods for microarray data analysisStatistical methods for microarray data analysis
Statistical methods for microarray data analysis
Springer
 

Semelhante a Flavivirus Group meeting (20)

Seminar Final.Key
Seminar Final.KeySeminar Final.Key
Seminar Final.Key
 
Cer cor11 franco-cercor-bhr199
Cer cor11 franco-cercor-bhr199Cer cor11 franco-cercor-bhr199
Cer cor11 franco-cercor-bhr199
 
Presentation on genetics of nitrogen fixation by Tahura Mariyam
Presentation on genetics of nitrogen fixation by Tahura MariyamPresentation on genetics of nitrogen fixation by Tahura Mariyam
Presentation on genetics of nitrogen fixation by Tahura Mariyam
 
Investigating the effect of natural variation on an unusual H9 wild isolate s...
Investigating the effect of natural variation on an unusual H9 wild isolate s...Investigating the effect of natural variation on an unusual H9 wild isolate s...
Investigating the effect of natural variation on an unusual H9 wild isolate s...
 
Summer Poster_PDF
Summer Poster_PDF Summer Poster_PDF
Summer Poster_PDF
 
Presentación plegable1
Presentación plegable1Presentación plegable1
Presentación plegable1
 
Presentación plegable 1
Presentación plegable 1Presentación plegable 1
Presentación plegable 1
 
Presentación plegable1
Presentación plegable1Presentación plegable1
Presentación plegable1
 
Rabies virus-Host Pathogen.pptx
Rabies virus-Host Pathogen.pptxRabies virus-Host Pathogen.pptx
Rabies virus-Host Pathogen.pptx
 
Neuroimmunology update
Neuroimmunology updateNeuroimmunology update
Neuroimmunology update
 
Seminario Biología Molecular- Laura Rivera.pdf
Seminario Biología Molecular- Laura Rivera.pdfSeminario Biología Molecular- Laura Rivera.pdf
Seminario Biología Molecular- Laura Rivera.pdf
 
Vector delivery
Vector deliveryVector delivery
Vector delivery
 
Neuromyelitis optica pathogenesis and aquaporin 4
Neuromyelitis optica pathogenesis and aquaporin 4Neuromyelitis optica pathogenesis and aquaporin 4
Neuromyelitis optica pathogenesis and aquaporin 4
 
Machula Thesis Proposal
Machula Thesis ProposalMachula Thesis Proposal
Machula Thesis Proposal
 
Recommended DNA Technology
Recommended DNA Technology Recommended DNA Technology
Recommended DNA Technology
 
Structure and function of dna
Structure and function of dnaStructure and function of dna
Structure and function of dna
 
Statistical methods for microarray data analysis
Statistical methods for microarray data analysisStatistical methods for microarray data analysis
Statistical methods for microarray data analysis
 
Statistical methods for microarray data analysis
Statistical methods for microarray data analysisStatistical methods for microarray data analysis
Statistical methods for microarray data analysis
 
Thesis_Ravvin
Thesis_RavvinThesis_Ravvin
Thesis_Ravvin
 
Evaluation 3
Evaluation 3Evaluation 3
Evaluation 3
 

Mais de Chakard Chalayut

Mais de Chakard Chalayut (20)

Data and personality introducing psychologic
Data and personality introducing psychologic Data and personality introducing psychologic
Data and personality introducing psychologic
 
The power of user psychology and behaviour
The power of user psychology and behaviourThe power of user psychology and behaviour
The power of user psychology and behaviour
 
Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability
 
Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing
 
Marketing Trend from Global
Marketing Trend from Global Marketing Trend from Global
Marketing Trend from Global
 
Digital media 2018
Digital media 2018Digital media 2018
Digital media 2018
 
about SXSW 2018 in AI topic
about SXSW 2018 in AI topicabout SXSW 2018 in AI topic
about SXSW 2018 in AI topic
 
World of chaos
World of chaosWorld of chaos
World of chaos
 
Total Experience Journey Management
Total Experience Journey Management Total Experience Journey Management
Total Experience Journey Management
 
Can we predict human future with data
Can we predict human future with dataCan we predict human future with data
Can we predict human future with data
 
End of content era, Long live the Human Experience
End of content era, Long live the Human Experience End of content era, Long live the Human Experience
End of content era, Long live the Human Experience
 
What da heck is Digital marketing?
What da heck is Digital marketing?What da heck is Digital marketing?
What da heck is Digital marketing?
 
Scratch 2 Social Media
Scratch 2 Social Media Scratch 2 Social Media
Scratch 2 Social Media
 
Scratch to Social Media
Scratch to Social Media Scratch to Social Media
Scratch to Social Media
 
Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry
 
Social Media for non profit
Social Media for non profitSocial Media for non profit
Social Media for non profit
 
Social media CRM
Social media CRMSocial media CRM
Social media CRM
 
Thinkcamp
ThinkcampThinkcamp
Thinkcamp
 
How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2
 
How to participate in Barcamp
How to participate in BarcampHow to participate in Barcamp
How to participate in Barcamp
 

Último

Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Dipal Arora
 
Call Girls Aurangabad Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Aurangabad Just Call 8250077686 Top Class Call Girl Service AvailableCall Girls Aurangabad Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Aurangabad Just Call 8250077686 Top Class Call Girl Service Available
Dipal Arora
 

Último (20)

Premium Bangalore Call Girls Jigani Dail 6378878445 Escort Service For Hot Ma...
Premium Bangalore Call Girls Jigani Dail 6378878445 Escort Service For Hot Ma...Premium Bangalore Call Girls Jigani Dail 6378878445 Escort Service For Hot Ma...
Premium Bangalore Call Girls Jigani Dail 6378878445 Escort Service For Hot Ma...
 
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
 
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
 
Premium Call Girls In Jaipur {8445551418} ❤️VVIP SEEMA Call Girl in Jaipur Ra...
Premium Call Girls In Jaipur {8445551418} ❤️VVIP SEEMA Call Girl in Jaipur Ra...Premium Call Girls In Jaipur {8445551418} ❤️VVIP SEEMA Call Girl in Jaipur Ra...
Premium Call Girls In Jaipur {8445551418} ❤️VVIP SEEMA Call Girl in Jaipur Ra...
 
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
 
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
 
Call Girls Gwalior Just Call 8617370543 Top Class Call Girl Service Available
Call Girls Gwalior Just Call 8617370543 Top Class Call Girl Service AvailableCall Girls Gwalior Just Call 8617370543 Top Class Call Girl Service Available
Call Girls Gwalior Just Call 8617370543 Top Class Call Girl Service Available
 
Call Girls Bareilly Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Bareilly Just Call 8250077686 Top Class Call Girl Service AvailableCall Girls Bareilly Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Bareilly Just Call 8250077686 Top Class Call Girl Service Available
 
Pondicherry Call Girls Book Now 9630942363 Top Class Pondicherry Escort Servi...
Pondicherry Call Girls Book Now 9630942363 Top Class Pondicherry Escort Servi...Pondicherry Call Girls Book Now 9630942363 Top Class Pondicherry Escort Servi...
Pondicherry Call Girls Book Now 9630942363 Top Class Pondicherry Escort Servi...
 
Call Girls Kochi Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Kochi Just Call 8250077686 Top Class Call Girl Service AvailableCall Girls Kochi Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Kochi Just Call 8250077686 Top Class Call Girl Service Available
 
Call Girls Aurangabad Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Aurangabad Just Call 8250077686 Top Class Call Girl Service AvailableCall Girls Aurangabad Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Aurangabad Just Call 8250077686 Top Class Call Girl Service Available
 
Call Girls Dehradun Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Dehradun Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Dehradun Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Dehradun Just Call 9907093804 Top Class Call Girl Service Available
 
Top Rated Bangalore Call Girls Mg Road ⟟ 9332606886 ⟟ Call Me For Genuine S...
Top Rated Bangalore Call Girls Mg Road ⟟   9332606886 ⟟ Call Me For Genuine S...Top Rated Bangalore Call Girls Mg Road ⟟   9332606886 ⟟ Call Me For Genuine S...
Top Rated Bangalore Call Girls Mg Road ⟟ 9332606886 ⟟ Call Me For Genuine S...
 
(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...
(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...
(Low Rate RASHMI ) Rate Of Call Girls Jaipur ❣ 8445551418 ❣ Elite Models & Ce...
 
Call Girls Jabalpur Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Jabalpur Just Call 8250077686 Top Class Call Girl Service AvailableCall Girls Jabalpur Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Jabalpur Just Call 8250077686 Top Class Call Girl Service Available
 
Top Rated Bangalore Call Girls Ramamurthy Nagar ⟟ 9332606886 ⟟ Call Me For G...
Top Rated Bangalore Call Girls Ramamurthy Nagar ⟟  9332606886 ⟟ Call Me For G...Top Rated Bangalore Call Girls Ramamurthy Nagar ⟟  9332606886 ⟟ Call Me For G...
Top Rated Bangalore Call Girls Ramamurthy Nagar ⟟ 9332606886 ⟟ Call Me For G...
 
Call Girls Siliguri Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Siliguri Just Call 8250077686 Top Class Call Girl Service AvailableCall Girls Siliguri Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Siliguri Just Call 8250077686 Top Class Call Girl Service Available
 
Top Rated Hyderabad Call Girls Erragadda ⟟ 9332606886 ⟟ Call Me For Genuine ...
Top Rated  Hyderabad Call Girls Erragadda ⟟ 9332606886 ⟟ Call Me For Genuine ...Top Rated  Hyderabad Call Girls Erragadda ⟟ 9332606886 ⟟ Call Me For Genuine ...
Top Rated Hyderabad Call Girls Erragadda ⟟ 9332606886 ⟟ Call Me For Genuine ...
 
Call Girls Agra Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Agra Just Call 8250077686 Top Class Call Girl Service AvailableCall Girls Agra Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Agra Just Call 8250077686 Top Class Call Girl Service Available
 
Call Girls Guntur Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Guntur  Just Call 8250077686 Top Class Call Girl Service AvailableCall Girls Guntur  Just Call 8250077686 Top Class Call Girl Service Available
Call Girls Guntur Just Call 8250077686 Top Class Call Girl Service Available
 

Flavivirus Group meeting