SlideShare uma empresa Scribd logo

Supporting the Teaching of the Holocaust and Genocide

•Transferir como PPT, PDF•
•
M
mlincoln

Presentation given at the Michigan Council for the Social Studies (February 2009) about instructional support for teaching the Holocaust and genocide.

Educação
1 de 24
Supporting the Teaching of the Holocaust and Genocide Karen R Todorov
Today’s presentation ,[object Object],[object Object],[object Object]
Teaching about the Holocaust and Genocide ,[object Object]
Genocide requires citizens to remain silent ,[object Object]
It is contemporary as well historical ,[object Object]
Inclusion in the HSCE ,[object Object]
Part of the mission of social studies ,[object Object]
Nine Expectations ,[object Object],[object Object],[object Object]
World History and Geography ,[object Object]
[object Object]
7.2.2 Inter-war Period – Analyze the transformations that shaped world societies between World War I and World War II by ,[object Object],[object Object]
Communist poster
7.2.3 World War II – Analyze the causes, course, characteristics, and immediate consequences of World War II by ,[object Object],[object Object],[object Object]
Nuremberg Trials
CG4 Conflict, Cooperation, and Security ,[object Object],[object Object],[object Object],[object Object],[object Object]
Darfur
United States History and Geography ,[object Object],[object Object]
7.2.1 Causes of WWII – Analyze the factors contributing to World War II in Europe and in the Pacific region, and America’s entry into war including ,[object Object],[object Object]
Values of Nazi Germany
7.2.2 U.S. and the Course of WWII – ,[object Object]
7.2.3 Impact of WWII on American Life – Analyze the changes in American life brought about by U.S. participation in World War II including ,[object Object],[object Object]
7.2.4 Responses to Genocide – ,[object Object]
Concentration Camps
Civics and Government ,[object Object]

Recomendados

Coldwar short ppt
Coldwar short pptColdwar short ppt
Coldwar short pptdrs412
 
1960's notes
1960's notes1960's notes
1960's notesFran Grover
 
New left 1960s
New left 1960sNew left 1960s
New left 1960sBuhleMaphumulo
 
The Legacy of McCarthyism
The Legacy of McCarthyismThe Legacy of McCarthyism
The Legacy of McCarthyismreghistory
 
Meet The Press: American Presidents
Meet The Press: American PresidentsMeet The Press: American Presidents
Meet The Press: American PresidentsGeorge Washington's Mount Vernon
 
EE Topics
EE TopicsEE Topics
EE TopicsJennifer Gaither
 
Video Reflection 1 Keckler-Alexander
Video Reflection 1 Keckler-AlexanderVideo Reflection 1 Keckler-Alexander
Video Reflection 1 Keckler-AlexanderKristin Keckler-Alexander
 
Short History of U.S. Public Diplomacy
Short History of U.S. Public DiplomacyShort History of U.S. Public Diplomacy
Short History of U.S. Public DiplomacyU.S Embassy in Belgrade (Serbia) / U.S. Department of State
 

Recomendados

Coldwar short ppt
Coldwar short pptColdwar short ppt
Coldwar short pptdrs412
 
1960's notes
1960's notes1960's notes
1960's notesFran Grover
 
New left 1960s
New left 1960sNew left 1960s
New left 1960sBuhleMaphumulo
 
The Legacy of McCarthyism
The Legacy of McCarthyismThe Legacy of McCarthyism
The Legacy of McCarthyismreghistory
 
Meet The Press: American Presidents
Meet The Press: American PresidentsMeet The Press: American Presidents
Meet The Press: American PresidentsGeorge Washington's Mount Vernon
 
EE Topics
EE TopicsEE Topics
EE TopicsJennifer Gaither
 
Video Reflection 1 Keckler-Alexander
Video Reflection 1 Keckler-AlexanderVideo Reflection 1 Keckler-Alexander
Video Reflection 1 Keckler-AlexanderKristin Keckler-Alexander
 
Short History of U.S. Public Diplomacy
Short History of U.S. Public DiplomacyShort History of U.S. Public Diplomacy
Short History of U.S. Public DiplomacyU.S Embassy in Belgrade (Serbia) / U.S. Department of State
 
End of the history and the last man
End of the history and the last manEnd of the history and the last man
End of the history and the last manSidra Aslam
 
Short History of U.S. Public Diplomacy
Short History of U.S. Public DiplomacyShort History of U.S. Public Diplomacy
Short History of U.S. Public DiplomacyU.S Embassy in Belgrade (Serbia) / U.S. Department of State
 
History of American Public Diplomacy v4 (Belgrade)
History of American Public Diplomacy v4 (Belgrade)History of American Public Diplomacy v4 (Belgrade)
History of American Public Diplomacy v4 (Belgrade)U.S Embassy in Belgrade (Serbia) / U.S. Department of State
 
Civil Rights
Civil RightsCivil Rights
Civil RightsMelissa
 
1960s
1960s1960s
1960sR. Scudder
 
Ch 25 The Sixties
Ch 25 The SixtiesCh 25 The Sixties
Ch 25 The SixtiesRick Fair
 
History of American Public Diplomacy (June 2014)
History of American Public Diplomacy (June 2014)History of American Public Diplomacy (June 2014)
History of American Public Diplomacy (June 2014)U.S Embassy in Belgrade (Serbia) / U.S. Department of State
 
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad MehbaliyevCivilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyevmehbaliyev
 
Effective from January 2013Syllabus for HIS353Holocaus.docx
Effective from January 2013Syllabus for HIS353Holocaus.docxEffective from January 2013Syllabus for HIS353Holocaus.docx
Effective from January 2013Syllabus for HIS353Holocaus.docxjack60216
 
xasan EU HISTORY.pptx
xasan EU HISTORY.pptxxasan EU HISTORY.pptx
xasan EU HISTORY.pptxAbdinasirAhmedMohame2
 
The risk of war among the united states and north korea
The risk of war among the united states and north koreaThe risk of war among the united states and north korea
The risk of war among the united states and north koreaFernando Alcoforado
 
Required ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docx
Required ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docxRequired ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docx
Required ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docxsodhi3
 
American History in a Global AGE1.pdf
American History in a Global AGE1.pdfAmerican History in a Global AGE1.pdf
American History in a Global AGE1.pdfLisa Riley
 
Early Action Syllabus
Early Action SyllabusEarly Action Syllabus
Early Action SyllabusMarkWhit
 
A level history
A level historyA level history
A level historyLavarelMustafa
 
sayid ali garad-1.pptx
sayid ali garad-1.pptxsayid ali garad-1.pptx
sayid ali garad-1.pptxAbdinasirAhmedMohame2
 
Americanization in the Modern World
Americanization in the Modern WorldAmericanization in the Modern World
Americanization in the Modern WorldEsteban Barbosa
 
97550 holocaust remembrance_may_2011
97550 holocaust remembrance_may_201197550 holocaust remembrance_may_2011
97550 holocaust remembrance_may_2011mediaminx
 
Ib History Internal Assessment--William J. Tolley
Ib History Internal Assessment--William J. TolleyIb History Internal Assessment--William J. Tolley
Ib History Internal Assessment--William J. Tolleywilliamjtolley
 
10.1 Origins of the Cold WarWorld War II left most of Europe in .docx
10.1 Origins of the Cold WarWorld War II left most of Europe in .docx10.1 Origins of the Cold WarWorld War II left most of Europe in .docx
10.1 Origins of the Cold WarWorld War II left most of Europe in .docxpaynetawnya
 
ferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfKanikaBansal52
 
New Media Essay. Media Essay General Paper H1 - GCE A Level Thinkswap
New Media Essay. Media Essay General Paper H1 - GCE A Level ThinkswapNew Media Essay. Media Essay General Paper H1 - GCE A Level Thinkswap
New Media Essay. Media Essay General Paper H1 - GCE A Level ThinkswapSara Roberts
 

Mais conteúdo relacionado

Mais procurados

End of the history and the last man
End of the history and the last manEnd of the history and the last man
End of the history and the last manSidra Aslam
 
Civil Rights
Civil RightsCivil Rights
Civil RightsMelissa
 
Ch 25 The Sixties
Ch 25 The SixtiesCh 25 The Sixties
Ch 25 The SixtiesRick Fair
 
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad MehbaliyevCivilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyevmehbaliyev
 

Mais procurados (8)

End of the history and the last man
End of the history and the last manEnd of the history and the last man
End of the history and the last man
 
Short History of U.S. Public Diplomacy
Short History of U.S. Public DiplomacyShort History of U.S. Public Diplomacy
Short History of U.S. Public Diplomacy
 
History of American Public Diplomacy v4 (Belgrade)
History of American Public Diplomacy v4 (Belgrade)History of American Public Diplomacy v4 (Belgrade)
History of American Public Diplomacy v4 (Belgrade)
 
Civil Rights
Civil RightsCivil Rights
Civil Rights
 
1960s
1960s1960s
1960s
 
Ch 25 The Sixties
Ch 25 The SixtiesCh 25 The Sixties
Ch 25 The Sixties
 
History of American Public Diplomacy (June 2014)
History of American Public Diplomacy (June 2014)History of American Public Diplomacy (June 2014)
History of American Public Diplomacy (June 2014)
 
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad MehbaliyevCivilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
 

Semelhante a Supporting the Teaching of the Holocaust and Genocide

Effective from January 2013Syllabus for HIS353Holocaus.docx
Effective from January 2013Syllabus for HIS353Holocaus.docxEffective from January 2013Syllabus for HIS353Holocaus.docx
Effective from January 2013Syllabus for HIS353Holocaus.docxjack60216
 
The risk of war among the united states and north korea
The risk of war among the united states and north koreaThe risk of war among the united states and north korea
The risk of war among the united states and north koreaFernando Alcoforado
 
Required ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docx
Required ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docxRequired ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docx
Required ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docxsodhi3
 
American History in a Global AGE1.pdf
American History in a Global AGE1.pdfAmerican History in a Global AGE1.pdf
American History in a Global AGE1.pdfLisa Riley
 
Early Action Syllabus
Early Action SyllabusEarly Action Syllabus
Early Action SyllabusMarkWhit
 
Americanization in the Modern World
Americanization in the Modern WorldAmericanization in the Modern World
Americanization in the Modern WorldEsteban Barbosa
 
97550 holocaust remembrance_may_2011
97550 holocaust remembrance_may_201197550 holocaust remembrance_may_2011
97550 holocaust remembrance_may_2011mediaminx
 
Ib History Internal Assessment--William J. Tolley
Ib History Internal Assessment--William J. TolleyIb History Internal Assessment--William J. Tolley
Ib History Internal Assessment--William J. Tolleywilliamjtolley
 
10.1 Origins of the Cold WarWorld War II left most of Europe in .docx
10.1 Origins of the Cold WarWorld War II left most of Europe in .docx10.1 Origins of the Cold WarWorld War II left most of Europe in .docx
10.1 Origins of the Cold WarWorld War II left most of Europe in .docxpaynetawnya
 
ferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfKanikaBansal52
 
New Media Essay. Media Essay General Paper H1 - GCE A Level Thinkswap
New Media Essay. Media Essay General Paper H1 - GCE A Level ThinkswapNew Media Essay. Media Essay General Paper H1 - GCE A Level Thinkswap
New Media Essay. Media Essay General Paper H1 - GCE A Level ThinkswapSara Roberts
 
Identity and representation
Identity and representationIdentity and representation
Identity and representationCarolina Matos
 
Digital unit plan template ww1
Digital unit plan template ww1Digital unit plan template ww1
Digital unit plan template ww1StevenStrawn1
 
Political Science 7 – International Relations - Power Point #7
Political Science 7 – International Relations - Power Point #7Political Science 7 – International Relations - Power Point #7
Political Science 7 – International Relations - Power Point #7John Paul Tabakian
 

Semelhante a Supporting the Teaching of the Holocaust and Genocide (20)

Effective from January 2013Syllabus for HIS353Holocaus.docx
Effective from January 2013Syllabus for HIS353Holocaus.docxEffective from January 2013Syllabus for HIS353Holocaus.docx
Effective from January 2013Syllabus for HIS353Holocaus.docx
 
xasan EU HISTORY.pptx
xasan EU HISTORY.pptxxasan EU HISTORY.pptx
xasan EU HISTORY.pptx
 
The risk of war among the united states and north korea
The risk of war among the united states and north koreaThe risk of war among the united states and north korea
The risk of war among the united states and north korea
 
Required ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docx
Required ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docxRequired ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docx
Required ResourcesTextBarnes, L. & Bowles, M. (2014). The Am.docx
 
American History in a Global AGE1.pdf
American History in a Global AGE1.pdfAmerican History in a Global AGE1.pdf
American History in a Global AGE1.pdf
 
Early Action Syllabus
Early Action SyllabusEarly Action Syllabus
Early Action Syllabus
 
A level history
A level historyA level history
A level history
 
sayid ali garad-1.pptx
sayid ali garad-1.pptxsayid ali garad-1.pptx
sayid ali garad-1.pptx
 
Americanization in the Modern World
Americanization in the Modern WorldAmericanization in the Modern World
Americanization in the Modern World
 
97550 holocaust remembrance_may_2011
97550 holocaust remembrance_may_201197550 holocaust remembrance_may_2011
97550 holocaust remembrance_may_2011
 
Ib History Internal Assessment--William J. Tolley
Ib History Internal Assessment--William J. TolleyIb History Internal Assessment--William J. Tolley
Ib History Internal Assessment--William J. Tolley
 
10.1 Origins of the Cold WarWorld War II left most of Europe in .docx
10.1 Origins of the Cold WarWorld War II left most of Europe in .docx10.1 Origins of the Cold WarWorld War II left most of Europe in .docx
10.1 Origins of the Cold WarWorld War II left most of Europe in .docx
 
ferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfferneeamericancivilwar.pdf
ferneeamericancivilwar.pdf
 
New Media Essay. Media Essay General Paper H1 - GCE A Level Thinkswap
New Media Essay. Media Essay General Paper H1 - GCE A Level ThinkswapNew Media Essay. Media Essay General Paper H1 - GCE A Level Thinkswap
New Media Essay. Media Essay General Paper H1 - GCE A Level Thinkswap
 
Untitled_(4).pdf
Untitled_(4).pdfUntitled_(4).pdf
Untitled_(4).pdf
 
Identity and representation
Identity and representationIdentity and representation
Identity and representation
 
Digital unit plan template ww1
Digital unit plan template ww1Digital unit plan template ww1
Digital unit plan template ww1
 
Political Science 7 – International Relations - Power Point #7
Political Science 7 – International Relations - Power Point #7Political Science 7 – International Relations - Power Point #7
Political Science 7 – International Relations - Power Point #7
 
55
5555
55
 
55
5555
55
 

Mais de mlincoln

LHS Technology Coach
LHS Technology CoachLHS Technology Coach
LHS Technology Coachmlincoln
 
In A Confined Silence Brysk 2012
In A Confined Silence Brysk 2012In A Confined Silence Brysk 2012
In A Confined Silence Brysk 2012mlincoln
 
ChildrenHolocaustBrysk2012
ChildrenHolocaustBrysk2012ChildrenHolocaustBrysk2012
ChildrenHolocaustBrysk2012mlincoln
 
Gale cengage
Gale cengageGale cengage
Gale cengagemlincoln
 
MeL Infotrac 2010
MeL Infotrac 2010MeL Infotrac 2010
MeL Infotrac 2010mlincoln
 
Infotrac PowerPoint
Infotrac PowerPointInfotrac PowerPoint
Infotrac PowerPointmlincoln
 
General Reference Center Gold
General Reference Center GoldGeneral Reference Center Gold
General Reference Center Goldmlincoln
 
Health Reference Center Academic: A Guide for Easy Use
Health Reference Center Academic: A Guide for Easy UseHealth Reference Center Academic: A Guide for Easy Use
Health Reference Center Academic: A Guide for Easy Usemlincoln
 
Health Reference Center Academic: How to Search
Health Reference Center Academic: How to SearchHealth Reference Center Academic: How to Search
Health Reference Center Academic: How to Searchmlincoln
 
Gale Infotrac Update
Gale Infotrac UpdateGale Infotrac Update
Gale Infotrac Updatemlincoln
 

Mais de mlincoln (10)

LHS Technology Coach
LHS Technology CoachLHS Technology Coach
LHS Technology Coach
 
In A Confined Silence Brysk 2012
In A Confined Silence Brysk 2012In A Confined Silence Brysk 2012
In A Confined Silence Brysk 2012
 
ChildrenHolocaustBrysk2012
ChildrenHolocaustBrysk2012ChildrenHolocaustBrysk2012
ChildrenHolocaustBrysk2012
 
Gale cengage
Gale cengageGale cengage
Gale cengage
 
MeL Infotrac 2010
MeL Infotrac 2010MeL Infotrac 2010
MeL Infotrac 2010
 
Infotrac PowerPoint
Infotrac PowerPointInfotrac PowerPoint
Infotrac PowerPoint
 
General Reference Center Gold
General Reference Center GoldGeneral Reference Center Gold
General Reference Center Gold
 
Health Reference Center Academic: A Guide for Easy Use
Health Reference Center Academic: A Guide for Easy UseHealth Reference Center Academic: A Guide for Easy Use
Health Reference Center Academic: A Guide for Easy Use
 
Health Reference Center Academic: How to Search
Health Reference Center Academic: How to SearchHealth Reference Center Academic: How to Search
Health Reference Center Academic: How to Search
 
Gale Infotrac Update
Gale Infotrac UpdateGale Infotrac Update
Gale Infotrac Update
 

Último

Key note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfKey note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfAdmir Softic
 
An Overview of Mutual Funds Bcom Project.pdf
An Overview of Mutual Funds Bcom Project.pdfAn Overview of Mutual Funds Bcom Project.pdf
An Overview of Mutual Funds Bcom Project.pdfSanaAli374401
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhikauryashika82
 
Gardella_PRCampaignConclusion Pitch Letter
Gardella_PRCampaignConclusion Pitch LetterGardella_PRCampaignConclusion Pitch Letter
Gardella_PRCampaignConclusion Pitch LetterMateoGardella
 
Measures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeMeasures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeThiyagu K
 
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin ClassesMixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin ClassesCeline George
 
Introduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The BasicsIntroduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The BasicsTechSoup
 
APM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across SectorsAPM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across SectorsAssociation for Project Management
 
Unit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptxUnit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptxVishalSingh1417
 
Unit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxUnit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxVishalSingh1417
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introductionMaksud Ahmed
 
Advanced Views - Calendar View in Odoo 17
Advanced Views - Calendar View in Odoo 17Advanced Views - Calendar View in Odoo 17
Advanced Views - Calendar View in Odoo 17Celine George
 
PROCESS RECORDING FORMAT.docx
PROCESS RECORDING FORMAT.docxPROCESS RECORDING FORMAT.docx
PROCESS RECORDING FORMAT.docxPoojaSen20
 
Z Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot GraphZ Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot GraphThiyagu K
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17Celine George
 
Web & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdfWeb & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdfJayanti Pande
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxDenish Jangid
 

Último (20)

Key note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfKey note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdf
 
Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024
 
An Overview of Mutual Funds Bcom Project.pdf
An Overview of Mutual Funds Bcom Project.pdfAn Overview of Mutual Funds Bcom Project.pdf
An Overview of Mutual Funds Bcom Project.pdf
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
 
Gardella_PRCampaignConclusion Pitch Letter
Gardella_PRCampaignConclusion Pitch LetterGardella_PRCampaignConclusion Pitch Letter
Gardella_PRCampaignConclusion Pitch Letter
 
Measures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeMeasures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and Mode
 
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin ClassesMixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
 
Introduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The BasicsIntroduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The Basics
 
APM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across SectorsAPM Welcome, APM North West Network Conference, Synergies Across Sectors
APM Welcome, APM North West Network Conference, Synergies Across Sectors
 
Unit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptxUnit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptx
 
Unit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxUnit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptx
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introduction
 
Advanced Views - Calendar View in Odoo 17
Advanced Views - Calendar View in Odoo 17Advanced Views - Calendar View in Odoo 17
Advanced Views - Calendar View in Odoo 17
 
Código Creativo y Arte de Software | Unidad 1
Código Creativo y Arte de Software | Unidad 1Código Creativo y Arte de Software | Unidad 1
Código Creativo y Arte de Software | Unidad 1
 
PROCESS RECORDING FORMAT.docx
PROCESS RECORDING FORMAT.docxPROCESS RECORDING FORMAT.docx
PROCESS RECORDING FORMAT.docx
 
Z Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot GraphZ Score,T Score, Percential Rank and Box Plot Graph
Z Score,T Score, Percential Rank and Box Plot Graph
 
How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17How to Give a Domain for a Field in Odoo 17
How to Give a Domain for a Field in Odoo 17
 
Web & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdfWeb & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdf
 
Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
 

Supporting the Teaching of the Holocaust and Genocide