SlideShare uma empresa Scribd logo
1 de 52
Increasingly Accurate Representation of Biochemistry (v2) Michel Dumontier , Ph.D. Assistant Professor of Bioinformatics Department of Biology, School of Computer Science Institute of Biochemistry, Ottawa Institute of Systems Biology Carleton University SemWeb Group::Vancouver 21/05/2009
Representational Issues Biochemical Identity Accurate Descriptions Precise Identifiers Modeling Situations
Which of these are different? # A, B Difference? 1 α -D-Glucose, alpha-D-Glucose  None, multiple names 2 α -D-Glucose,  β -D-Glucose 3 α -D-Glucose,  β -D-Glucose, D-Glucose 4 α -D-Glucose,  α -D-Glucose-6-phosphate 5 Hk, Hk(L529S) 6 Hk(human), Hk(mouse) 7 Hk(open), Hk(closed) 8 Hk (L529), Hk (L540) 9 Hk (L529), Hk (A530)
α -D-Glucose vs  β -D-Glucose ,[object Object],[object Object]
α -D-Glucose and  β -D-Glucose are more specific types* of D-Glucose * They resolve an ambiguity in stereochemistry
α -D-Glucose vs   α -D-Glucose-6-Phosphate ,[object Object],[object Object],[object Object]
Post-Translational Modifications ,[object Object],[object Object]
Hexokinase (mutation) 50 0   51 0   52 0   53 0   54 0   RRFHKTLRRL VPDSDVRFLL SESGSGKGAA MVTAVAYR S A EQHRQIEETL 50 0   51 0   52 0   53 0   54 0   RRFHKTLRRL VPDSDVRFLL SESGSGKGAA MVTAVAYRLA EQHRQIEETL Leads to hemolytic anemia different sequence = different entity related by some mutation process
Hexokinase (human vs mouse) >sp|P19367|HXK1_HUMAN Hexokinase-1 OS=Homo sapiens GN=HK1 PE=1 SV=3 MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTAT VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVH GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGV EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRV LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD IRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG  AALITAVGVRLRTEASS >sp|P17710|HXK1_MOUSE Hexokinase-1 OS=Mus musculus GN=Hk1 PE=1 SV=2 MGWGAPLLSRMLHGPGQAGETSPVPERQSGSENPASEDRRPLEKQCSHHLYTMGQNCQRG QAVDVEPKIRPPLTEEKIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTASVKML PTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPENIVHGSGS QLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGVEGAD VVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRH IDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGMYMGE LVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETDKEGVQNAKEILTRLGVEPS HDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMHPQYS RRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLSHFRLSKQAL MEVKKKLRSEMEMGLRKETNSRATVKMLPSYVRSIPDGTEHGDFLALDLGGTNFRVLLVK IRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGFTFSF PCKQTSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVGTMMT CAYEEPSCEIGLIVGTGSNACYMEEMKNVEMVEGNQGQMCINMEWGAFGDNGCLDDIRTD FDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFET KFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAAVVQK IRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFLLSEDGSGKGAALI  TAVGVRLRGDPTNA
Hexokinase ,[object Object],[object Object]
Parts need to be identifiable and describable # A, B Difference? 1 α -D-Glucose, alpha-D-Glucose  None, multiple names 2 α -D-Glucose,  β -D-Glucose Structural (rearrangement) 3 α -D-Glucose,  β -D-Glucose, D-Glucose More specific type 4 α -D-Glucose,  α -D-Glucose-6-phosphate Structural (modification) 5 Hk, Hk(L529S) Structural (mutation) 6 Hk(human), Hk(mouse) Structural (sequence) 7 Hk(open), Hk(closed) Conformational 8 Hk (L529), Hk (L540) Positional 9 Hk (L529), Hk (A530) Structural, positional
Biochemical identity  is necessarily based on a description of structure
To determine identity, we have  compare  their descriptions
Given A and B How would you know that they are different?
[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Biochemical identity  is necessarily based on having accurate descriptions
Yet, current approaches add *annotations* rather than create new records with their respective descriptions
 
Current approach to assigning biochemical identifiers is erroneous, misleading or underspecified ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Biochemical relationship  is necessarily based on a  comparison  of accurate descriptions
For each description, we must assign a unique name or identifier
If the description changes we need a new identifier!
1. Precise Biochemical Identifiers ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Different molecules  must  have different identifiers  ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
(S)-Glutamic Acid InChI= {version}1 /{formula}C5H9NO4 /c{connections}6-3(5(9)10)1-2-4(7)8 /h{H_atoms}3H,1-2,6H2,(H,7,8)(H,9,10) /p{protons}+1 /t{stereo:sp3}3- /m{stereo:sp3:inverted}0 /s{stereo:type (1=abs, 2=rel, 3=rac)}1 /i{isotopic:atoms}4+1
2. Accurate Descriptions CML SDF O1[C@@H]([C@@H](O)([C@H](O)([C@@H](O)([C@@H]1(O)))))(CO) 79025 IUPAC InChI=1/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3-,4+,5-,6+/m1/s1 InCHI α -D-Glucose 6-(hydroxymethyl)oxane-2,3,4,5-tetrol OR (2R,3R,4S,5R,6R)-6 -(hydroxymethyl)tetrahydro -2H-pyran-2,3,4,5-tetraol  SMILES
OWL Has Explicit Semantics ,[object Object]
Chemical Ontology Chemical Knowledge for the Semantic Web. Mykola Konyk ,  Alexander De Leon , and  Michel Dumontier .  LNBI . 2008. 5109:169-176.  Data Integration in the Life Sciences (DILS2008) . Evry. France. 
RDF/OWL descriptions of molecules http://code.google.com/p/semanticwebopenbabel/
Describing chemical functional groups in OWL-DL for the classification of chemical compounds hydroxyl group methyl group Knowledge of functional groups is important in chemical synthesis, pharmaceutical design and lead optimization. Functional groups describe chemical reactivity in terms of atoms and their connectivity, and exhibits characteristic chemical behavior when present in a compound.  N Villanueva-Rosales, MDumontier. 2007. OWLED, Innsbruck, Austria. Ethanol
Describing Functional Groups in DL ,[object Object],[object Object],O H R R group
Fully Classified Ontology 35 FG
And, we define certain compounds ,[object Object],[object Object]
Organic Compound Ontology 28 OC
Question Answering ,[object Object],[object Object]
We also need  Identifiers/Descriptions for Atoms ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
What about identifiers for collection of atoms? ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Can we reuse our positional nomenclature for residues? ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
While we’re at it, we could extend our expressive capability to create broader descriptions: ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
So what if... ,[object Object],[object Object]
Biological Identifier Service
Description to Identifier
What does this mean? ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Case Study: HIF1 α ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],Multiple structural forms Part, named/ unnamed regions The part is the agent in the process Selective interaction with parts
Structure-based biochemical identity: Differences between apples and oranges ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Uniprot example revisited ,[object Object],[object Object],[object Object],:A rdfs:subClassOf :Hydroxylation :A hasParticipant (:0#r402 and :Substrate) :A hasParticipant (:1#r402 and :Product) :A hasParticipant (:5 and :Enzyme) :B rdfs:subClassOf :Interaction :B :hasParticipant (:2#r402 or :3#r564 or :4#r402,r564) :B :hasParticipant (:6) :1 (HIF1 α ) :2 (HIF1 α  + P402hyd) :3 (HIF1 α  + P564hyd) :4 (HIF1 α  + P402hyd + P564hyd) :5 (EGLN1) :6 (VHL) Please ignore the made up short-hand syntax!
Situational Modeling
Infering Protein Participation  ,[object Object],[object Object],[object Object],:0#r402 :isPartOf :0 :1#r402 :isPartOf :1 :A rdfs:subClassOf :Hydroxylation :A hasParticipant (:0#r402 and :Substrate) :A hasParticipant (:1#r402 and :Product) :A hasParticipant :0 :A hasParticipant :1
We will add new knowledge about biochemicals and their parts into the linked data web through Bio2RDF!
Query descriptions to find matching biochemicals ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
Summary ,[object Object],[object Object],[object Object],[object Object],[object Object],[object Object]
dumontierlab.com [email_address] Special thanks to PhD Student Leonid Chepelev for insightful discussions   semanticscience.org

Mais conteúdo relacionado

Destaque

University Students Fighting World Hunger - Slacktivism vs. Activism. Does a ...
University Students Fighting World Hunger - Slacktivism vs. Activism. Does a ...University Students Fighting World Hunger - Slacktivism vs. Activism. Does a ...
University Students Fighting World Hunger - Slacktivism vs. Activism. Does a ...Sascha Funk
 
(Online) Censorship in Southeast Asia | #rp15
(Online) Censorship in Southeast Asia | #rp15(Online) Censorship in Southeast Asia | #rp15
(Online) Censorship in Southeast Asia | #rp15Sascha Funk
 
BigScrum - Scaling Teams to Programs
BigScrum - Scaling Teams to ProgramsBigScrum - Scaling Teams to Programs
BigScrum - Scaling Teams to ProgramsThinkLouder
 
Socialmediastenden
SocialmediastendenSocialmediastenden
SocialmediastendenSascha Funk
 
SecurVoice Call Recording
SecurVoice Call RecordingSecurVoice Call Recording
SecurVoice Call RecordingCrawford6003
 
web pre-10.pdf
web pre-10.pdfweb pre-10.pdf
web pre-10.pdfs1160122
 
My Powerpoint
My PowerpointMy Powerpoint
My PowerpointUruguayo
 
Wmp Firefox Plugin License
Wmp Firefox Plugin LicenseWmp Firefox Plugin License
Wmp Firefox Plugin Licensejyimbo
 

Destaque (15)

University Students Fighting World Hunger - Slacktivism vs. Activism. Does a ...
University Students Fighting World Hunger - Slacktivism vs. Activism. Does a ...University Students Fighting World Hunger - Slacktivism vs. Activism. Does a ...
University Students Fighting World Hunger - Slacktivism vs. Activism. Does a ...
 
Cloud ntino-krampis
Cloud ntino-krampisCloud ntino-krampis
Cloud ntino-krampis
 
pebbleのお話し
pebbleのお話しpebbleのお話し
pebbleのお話し
 
Social Media Summit
Social Media SummitSocial Media Summit
Social Media Summit
 
Flowers
FlowersFlowers
Flowers
 
Eportfolio
EportfolioEportfolio
Eportfolio
 
(Online) Censorship in Southeast Asia | #rp15
(Online) Censorship in Southeast Asia | #rp15(Online) Censorship in Southeast Asia | #rp15
(Online) Censorship in Southeast Asia | #rp15
 
BigScrum - Scaling Teams to Programs
BigScrum - Scaling Teams to ProgramsBigScrum - Scaling Teams to Programs
BigScrum - Scaling Teams to Programs
 
Socialmediastenden
SocialmediastendenSocialmediastenden
Socialmediastenden
 
SecurVoice Call Recording
SecurVoice Call RecordingSecurVoice Call Recording
SecurVoice Call Recording
 
Los gansos
Los gansosLos gansos
Los gansos
 
Workplace sprituality
Workplace spritualityWorkplace sprituality
Workplace sprituality
 
web pre-10.pdf
web pre-10.pdfweb pre-10.pdf
web pre-10.pdf
 
My Powerpoint
My PowerpointMy Powerpoint
My Powerpoint
 
Wmp Firefox Plugin License
Wmp Firefox Plugin LicenseWmp Firefox Plugin License
Wmp Firefox Plugin License
 

Semelhante a Increasingly Accurate Representation of Biochemistry (v2)

20090511 Manchester Biochemistry
20090511 Manchester Biochemistry20090511 Manchester Biochemistry
20090511 Manchester BiochemistryMichel Dumontier
 
Prediction of protein function
Prediction of protein functionPrediction of protein function
Prediction of protein functionLars Juhl Jensen
 
Bioinformatica 20-10-2011-t3-scoring matrices
Bioinformatica 20-10-2011-t3-scoring matricesBioinformatica 20-10-2011-t3-scoring matrices
Bioinformatica 20-10-2011-t3-scoring matricesProf. Wim Van Criekinge
 
Pep Talk San Diego 011311
Pep Talk San Diego 011311Pep Talk San Diego 011311
Pep Talk San Diego 011311Philip Bourne
 
Insilico methods for design of novel inhibitors of Human leukocyte elastase
Insilico methods for design of novel inhibitors of Human leukocyte elastaseInsilico methods for design of novel inhibitors of Human leukocyte elastase
Insilico methods for design of novel inhibitors of Human leukocyte elastaseJayashankar Lakshmanan
 
Thesis def
Thesis defThesis def
Thesis defJay Vyas
 
Prediction of transcription factor binding to DNA using rule induction methods
Prediction of transcription factor binding to DNA using rule induction methodsPrediction of transcription factor binding to DNA using rule induction methods
Prediction of transcription factor binding to DNA using rule induction methodsziggurat
 
Research report (alternative splicing, protein structure; retinitis pigmentosa)
Research report (alternative splicing, protein structure; retinitis pigmentosa)Research report (alternative splicing, protein structure; retinitis pigmentosa)
Research report (alternative splicing, protein structure; retinitis pigmentosa)avalgar
 
Transcriptomics and lexico-syntactic analysis
Transcriptomics and lexico-syntactic analysisTranscriptomics and lexico-syntactic analysis
Transcriptomics and lexico-syntactic analysisLars Juhl Jensen
 
Bioinfomatics Presentation
Bioinfomatics PresentationBioinfomatics Presentation
Bioinfomatics PresentationZhenhong Bao
 
2015 US Combustion Meeting - West - Identification, Correction, and Compariso...
2015 US Combustion Meeting - West - Identification, Correction, and Compariso...2015 US Combustion Meeting - West - Identification, Correction, and Compariso...
2015 US Combustion Meeting - West - Identification, Correction, and Compariso...Richard West
 
Inferring microbial ecosystem function from community structure
Inferring microbial ecosystem function from community structureInferring microbial ecosystem function from community structure
Inferring microbial ecosystem function from community structureJeff Bowman
 
Computation and System Biology Assignment Help
Computation and System Biology Assignment HelpComputation and System Biology Assignment Help
Computation and System Biology Assignment HelpNursing Assignment Help
 
Practical 7 dna, rna and the flow of genetic information5
Practical 7 dna, rna and the flow of genetic information5Practical 7 dna, rna and the flow of genetic information5
Practical 7 dna, rna and the flow of genetic information5Osama Barayan
 
Tag snp selection using quine mc cluskey optimization method-2
Tag snp selection using quine mc cluskey optimization method-2Tag snp selection using quine mc cluskey optimization method-2
Tag snp selection using quine mc cluskey optimization method-2IAEME Publication
 
Research Inventy : International Journal of Engineering and Science
Research Inventy : International Journal of Engineering and ScienceResearch Inventy : International Journal of Engineering and Science
Research Inventy : International Journal of Engineering and Scienceresearchinventy
 
Austin Journal of Computational Biology and Bioinformatics
Austin Journal of Computational Biology and BioinformaticsAustin Journal of Computational Biology and Bioinformatics
Austin Journal of Computational Biology and BioinformaticsAustin Publishing Group
 

Semelhante a Increasingly Accurate Representation of Biochemistry (v2) (20)

20090511 Manchester Biochemistry
20090511 Manchester Biochemistry20090511 Manchester Biochemistry
20090511 Manchester Biochemistry
 
Prediction of protein function
Prediction of protein functionPrediction of protein function
Prediction of protein function
 
Bioinformatica 20-10-2011-t3-scoring matrices
Bioinformatica 20-10-2011-t3-scoring matricesBioinformatica 20-10-2011-t3-scoring matrices
Bioinformatica 20-10-2011-t3-scoring matrices
 
Bioinformatica 08-12-2011-t8-go-hmm
Bioinformatica 08-12-2011-t8-go-hmmBioinformatica 08-12-2011-t8-go-hmm
Bioinformatica 08-12-2011-t8-go-hmm
 
Biological databases
Biological databasesBiological databases
Biological databases
 
Pep Talk San Diego 011311
Pep Talk San Diego 011311Pep Talk San Diego 011311
Pep Talk San Diego 011311
 
Insilico methods for design of novel inhibitors of Human leukocyte elastase
Insilico methods for design of novel inhibitors of Human leukocyte elastaseInsilico methods for design of novel inhibitors of Human leukocyte elastase
Insilico methods for design of novel inhibitors of Human leukocyte elastase
 
Thesis def
Thesis defThesis def
Thesis def
 
Prediction of transcription factor binding to DNA using rule induction methods
Prediction of transcription factor binding to DNA using rule induction methodsPrediction of transcription factor binding to DNA using rule induction methods
Prediction of transcription factor binding to DNA using rule induction methods
 
Research report (alternative splicing, protein structure; retinitis pigmentosa)
Research report (alternative splicing, protein structure; retinitis pigmentosa)Research report (alternative splicing, protein structure; retinitis pigmentosa)
Research report (alternative splicing, protein structure; retinitis pigmentosa)
 
Proteomics
ProteomicsProteomics
Proteomics
 
Transcriptomics and lexico-syntactic analysis
Transcriptomics and lexico-syntactic analysisTranscriptomics and lexico-syntactic analysis
Transcriptomics and lexico-syntactic analysis
 
Bioinfomatics Presentation
Bioinfomatics PresentationBioinfomatics Presentation
Bioinfomatics Presentation
 
2015 US Combustion Meeting - West - Identification, Correction, and Compariso...
2015 US Combustion Meeting - West - Identification, Correction, and Compariso...2015 US Combustion Meeting - West - Identification, Correction, and Compariso...
2015 US Combustion Meeting - West - Identification, Correction, and Compariso...
 
Inferring microbial ecosystem function from community structure
Inferring microbial ecosystem function from community structureInferring microbial ecosystem function from community structure
Inferring microbial ecosystem function from community structure
 
Computation and System Biology Assignment Help
Computation and System Biology Assignment HelpComputation and System Biology Assignment Help
Computation and System Biology Assignment Help
 
Practical 7 dna, rna and the flow of genetic information5
Practical 7 dna, rna and the flow of genetic information5Practical 7 dna, rna and the flow of genetic information5
Practical 7 dna, rna and the flow of genetic information5
 
Tag snp selection using quine mc cluskey optimization method-2
Tag snp selection using quine mc cluskey optimization method-2Tag snp selection using quine mc cluskey optimization method-2
Tag snp selection using quine mc cluskey optimization method-2
 
Research Inventy : International Journal of Engineering and Science
Research Inventy : International Journal of Engineering and ScienceResearch Inventy : International Journal of Engineering and Science
Research Inventy : International Journal of Engineering and Science
 
Austin Journal of Computational Biology and Bioinformatics
Austin Journal of Computational Biology and BioinformaticsAustin Journal of Computational Biology and Bioinformatics
Austin Journal of Computational Biology and Bioinformatics
 

Mais de Michel Dumontier

A metadata standard for Knowledge Graphs
A metadata standard for Knowledge GraphsA metadata standard for Knowledge Graphs
A metadata standard for Knowledge GraphsMichel Dumontier
 
Data-Driven Discovery Science with FAIR Knowledge Graphs
Data-Driven Discovery Science with FAIR Knowledge GraphsData-Driven Discovery Science with FAIR Knowledge Graphs
Data-Driven Discovery Science with FAIR Knowledge GraphsMichel Dumontier
 
The Role of the FAIR Guiding Principles for an effective Learning Health System
The Role of the FAIR Guiding Principles for an effective Learning Health SystemThe Role of the FAIR Guiding Principles for an effective Learning Health System
The Role of the FAIR Guiding Principles for an effective Learning Health SystemMichel Dumontier
 
CIKM2020 Keynote: Accelerating discovery science with an Internet of FAIR dat...
CIKM2020 Keynote: Accelerating discovery science with an Internet of FAIR dat...CIKM2020 Keynote: Accelerating discovery science with an Internet of FAIR dat...
CIKM2020 Keynote: Accelerating discovery science with an Internet of FAIR dat...Michel Dumontier
 
The role of the FAIR Guiding Principles in a Learning Health System
The role of the FAIR Guiding Principles in a Learning Health SystemThe role of the FAIR Guiding Principles in a Learning Health System
The role of the FAIR Guiding Principles in a Learning Health SystemMichel Dumontier
 
Acclerating biomedical discovery with an internet of FAIR data and services -...
Acclerating biomedical discovery with an internet of FAIR data and services -...Acclerating biomedical discovery with an internet of FAIR data and services -...
Acclerating biomedical discovery with an internet of FAIR data and services -...Michel Dumontier
 
Accelerating Biomedical Research with the Emerging Internet of FAIR Data and ...
Accelerating Biomedical Research with the Emerging Internet of FAIR Data and ...Accelerating Biomedical Research with the Emerging Internet of FAIR Data and ...
Accelerating Biomedical Research with the Emerging Internet of FAIR Data and ...Michel Dumontier
 
Are we FAIR yet? And will it be worth it?
Are we FAIR yet? And will it be worth it?Are we FAIR yet? And will it be worth it?
Are we FAIR yet? And will it be worth it?Michel Dumontier
 
The Future of FAIR Data: An international social, legal and technological inf...
The Future of FAIR Data: An international social, legal and technological inf...The Future of FAIR Data: An international social, legal and technological inf...
The Future of FAIR Data: An international social, legal and technological inf...Michel Dumontier
 
Keynote at the 2018 Maastricht University Dinner
Keynote at the 2018 Maastricht University DinnerKeynote at the 2018 Maastricht University Dinner
Keynote at the 2018 Maastricht University DinnerMichel Dumontier
 
The future of science and business - a UM Star Lecture
The future of science and business - a UM Star LectureThe future of science and business - a UM Star Lecture
The future of science and business - a UM Star LectureMichel Dumontier
 
Developing and assessing FAIR digital resources
Developing and assessing FAIR digital resourcesDeveloping and assessing FAIR digital resources
Developing and assessing FAIR digital resourcesMichel Dumontier
 
Advancing Biomedical Knowledge Reuse with FAIR
Advancing Biomedical Knowledge Reuse with FAIRAdvancing Biomedical Knowledge Reuse with FAIR
Advancing Biomedical Knowledge Reuse with FAIRMichel Dumontier
 
A Framework to develop the FAIR Metrics
A Framework to develop the FAIR MetricsA Framework to develop the FAIR Metrics
A Framework to develop the FAIR MetricsMichel Dumontier
 
FAIR principles and metrics for evaluation
FAIR principles and metrics for evaluationFAIR principles and metrics for evaluation
FAIR principles and metrics for evaluationMichel Dumontier
 
Towards metrics to assess and encourage FAIRness
Towards metrics to assess and encourage FAIRnessTowards metrics to assess and encourage FAIRness
Towards metrics to assess and encourage FAIRnessMichel Dumontier
 

Mais de Michel Dumontier (20)

A metadata standard for Knowledge Graphs
A metadata standard for Knowledge GraphsA metadata standard for Knowledge Graphs
A metadata standard for Knowledge Graphs
 
Data-Driven Discovery Science with FAIR Knowledge Graphs
Data-Driven Discovery Science with FAIR Knowledge GraphsData-Driven Discovery Science with FAIR Knowledge Graphs
Data-Driven Discovery Science with FAIR Knowledge Graphs
 
Evaluating FAIRness
Evaluating FAIRnessEvaluating FAIRness
Evaluating FAIRness
 
The Role of the FAIR Guiding Principles for an effective Learning Health System
The Role of the FAIR Guiding Principles for an effective Learning Health SystemThe Role of the FAIR Guiding Principles for an effective Learning Health System
The Role of the FAIR Guiding Principles for an effective Learning Health System
 
CIKM2020 Keynote: Accelerating discovery science with an Internet of FAIR dat...
CIKM2020 Keynote: Accelerating discovery science with an Internet of FAIR dat...CIKM2020 Keynote: Accelerating discovery science with an Internet of FAIR dat...
CIKM2020 Keynote: Accelerating discovery science with an Internet of FAIR dat...
 
The role of the FAIR Guiding Principles in a Learning Health System
The role of the FAIR Guiding Principles in a Learning Health SystemThe role of the FAIR Guiding Principles in a Learning Health System
The role of the FAIR Guiding Principles in a Learning Health System
 
Acclerating biomedical discovery with an internet of FAIR data and services -...
Acclerating biomedical discovery with an internet of FAIR data and services -...Acclerating biomedical discovery with an internet of FAIR data and services -...
Acclerating biomedical discovery with an internet of FAIR data and services -...
 
Accelerating Biomedical Research with the Emerging Internet of FAIR Data and ...
Accelerating Biomedical Research with the Emerging Internet of FAIR Data and ...Accelerating Biomedical Research with the Emerging Internet of FAIR Data and ...
Accelerating Biomedical Research with the Emerging Internet of FAIR Data and ...
 
Are we FAIR yet? And will it be worth it?
Are we FAIR yet? And will it be worth it?Are we FAIR yet? And will it be worth it?
Are we FAIR yet? And will it be worth it?
 
The Future of FAIR Data: An international social, legal and technological inf...
The Future of FAIR Data: An international social, legal and technological inf...The Future of FAIR Data: An international social, legal and technological inf...
The Future of FAIR Data: An international social, legal and technological inf...
 
Keynote at the 2018 Maastricht University Dinner
Keynote at the 2018 Maastricht University DinnerKeynote at the 2018 Maastricht University Dinner
Keynote at the 2018 Maastricht University Dinner
 
The future of science and business - a UM Star Lecture
The future of science and business - a UM Star LectureThe future of science and business - a UM Star Lecture
The future of science and business - a UM Star Lecture
 
Are we FAIR yet?
Are we FAIR yet?Are we FAIR yet?
Are we FAIR yet?
 
Developing and assessing FAIR digital resources
Developing and assessing FAIR digital resourcesDeveloping and assessing FAIR digital resources
Developing and assessing FAIR digital resources
 
Advancing Biomedical Knowledge Reuse with FAIR
Advancing Biomedical Knowledge Reuse with FAIRAdvancing Biomedical Knowledge Reuse with FAIR
Advancing Biomedical Knowledge Reuse with FAIR
 
A Framework to develop the FAIR Metrics
A Framework to develop the FAIR MetricsA Framework to develop the FAIR Metrics
A Framework to develop the FAIR Metrics
 
FAIR principles and metrics for evaluation
FAIR principles and metrics for evaluationFAIR principles and metrics for evaluation
FAIR principles and metrics for evaluation
 
Towards metrics to assess and encourage FAIRness
Towards metrics to assess and encourage FAIRnessTowards metrics to assess and encourage FAIRness
Towards metrics to assess and encourage FAIRness
 
Data Science for the Win
Data Science for the WinData Science for the Win
Data Science for the Win
 
2016 bmdid-mappings
2016 bmdid-mappings2016 bmdid-mappings
2016 bmdid-mappings
 

Último

Understanding Discord NSFW Servers A Guide for Responsible Users.pdf
Understanding Discord NSFW Servers A Guide for Responsible Users.pdfUnderstanding Discord NSFW Servers A Guide for Responsible Users.pdf
Understanding Discord NSFW Servers A Guide for Responsible Users.pdfUK Journal
 
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptxHampshireHUG
 
Handwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed textsHandwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed textsMaria Levchenko
 
Breaking the Kubernetes Kill Chain: Host Path Mount
Breaking the Kubernetes Kill Chain: Host Path MountBreaking the Kubernetes Kill Chain: Host Path Mount
Breaking the Kubernetes Kill Chain: Host Path MountPuma Security, LLC
 
08448380779 Call Girls In Greater Kailash - I Women Seeking Men
08448380779 Call Girls In Greater Kailash - I Women Seeking Men08448380779 Call Girls In Greater Kailash - I Women Seeking Men
08448380779 Call Girls In Greater Kailash - I Women Seeking MenDelhi Call girls
 
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...Neo4j
 
A Year of the Servo Reboot: Where Are We Now?
A Year of the Servo Reboot: Where Are We Now?A Year of the Servo Reboot: Where Are We Now?
A Year of the Servo Reboot: Where Are We Now?Igalia
 
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...Miguel Araújo
 
CNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of ServiceCNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of Servicegiselly40
 
2024: Domino Containers - The Next Step. News from the Domino Container commu...
2024: Domino Containers - The Next Step. News from the Domino Container commu...2024: Domino Containers - The Next Step. News from the Domino Container commu...
2024: Domino Containers - The Next Step. News from the Domino Container commu...Martijn de Jong
 
GenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day PresentationGenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day PresentationMichael W. Hawkins
 
Exploring the Future Potential of AI-Enabled Smartphone Processors
Exploring the Future Potential of AI-Enabled Smartphone ProcessorsExploring the Future Potential of AI-Enabled Smartphone Processors
Exploring the Future Potential of AI-Enabled Smartphone Processorsdebabhi2
 
Tata AIG General Insurance Company - Insurer Innovation Award 2024
Tata AIG General Insurance Company - Insurer Innovation Award 2024Tata AIG General Insurance Company - Insurer Innovation Award 2024
Tata AIG General Insurance Company - Insurer Innovation Award 2024The Digital Insurer
 
Histor y of HAM Radio presentation slide
Histor y of HAM Radio presentation slideHistor y of HAM Radio presentation slide
Histor y of HAM Radio presentation slidevu2urc
 
Automating Google Workspace (GWS) & more with Apps Script
Automating Google Workspace (GWS) & more with Apps ScriptAutomating Google Workspace (GWS) & more with Apps Script
Automating Google Workspace (GWS) & more with Apps Scriptwesley chun
 
08448380779 Call Girls In Diplomatic Enclave Women Seeking Men
08448380779 Call Girls In Diplomatic Enclave Women Seeking Men08448380779 Call Girls In Diplomatic Enclave Women Seeking Men
08448380779 Call Girls In Diplomatic Enclave Women Seeking MenDelhi Call girls
 
Scaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organizationScaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organizationRadu Cotescu
 
Factors to Consider When Choosing Accounts Payable Services Providers.pptx
Factors to Consider When Choosing Accounts Payable Services Providers.pptxFactors to Consider When Choosing Accounts Payable Services Providers.pptx
Factors to Consider When Choosing Accounts Payable Services Providers.pptxKatpro Technologies
 
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024The Digital Insurer
 
The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024Rafal Los
 

Último (20)

Understanding Discord NSFW Servers A Guide for Responsible Users.pdf
Understanding Discord NSFW Servers A Guide for Responsible Users.pdfUnderstanding Discord NSFW Servers A Guide for Responsible Users.pdf
Understanding Discord NSFW Servers A Guide for Responsible Users.pdf
 
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
 
Handwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed textsHandwritten Text Recognition for manuscripts and early printed texts
Handwritten Text Recognition for manuscripts and early printed texts
 
Breaking the Kubernetes Kill Chain: Host Path Mount
Breaking the Kubernetes Kill Chain: Host Path MountBreaking the Kubernetes Kill Chain: Host Path Mount
Breaking the Kubernetes Kill Chain: Host Path Mount
 
08448380779 Call Girls In Greater Kailash - I Women Seeking Men
08448380779 Call Girls In Greater Kailash - I Women Seeking Men08448380779 Call Girls In Greater Kailash - I Women Seeking Men
08448380779 Call Girls In Greater Kailash - I Women Seeking Men
 
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
 
A Year of the Servo Reboot: Where Are We Now?
A Year of the Servo Reboot: Where Are We Now?A Year of the Servo Reboot: Where Are We Now?
A Year of the Servo Reboot: Where Are We Now?
 
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
 
CNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of ServiceCNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of Service
 
2024: Domino Containers - The Next Step. News from the Domino Container commu...
2024: Domino Containers - The Next Step. News from the Domino Container commu...2024: Domino Containers - The Next Step. News from the Domino Container commu...
2024: Domino Containers - The Next Step. News from the Domino Container commu...
 
GenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day PresentationGenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day Presentation
 
Exploring the Future Potential of AI-Enabled Smartphone Processors
Exploring the Future Potential of AI-Enabled Smartphone ProcessorsExploring the Future Potential of AI-Enabled Smartphone Processors
Exploring the Future Potential of AI-Enabled Smartphone Processors
 
Tata AIG General Insurance Company - Insurer Innovation Award 2024
Tata AIG General Insurance Company - Insurer Innovation Award 2024Tata AIG General Insurance Company - Insurer Innovation Award 2024
Tata AIG General Insurance Company - Insurer Innovation Award 2024
 
Histor y of HAM Radio presentation slide
Histor y of HAM Radio presentation slideHistor y of HAM Radio presentation slide
Histor y of HAM Radio presentation slide
 
Automating Google Workspace (GWS) & more with Apps Script
Automating Google Workspace (GWS) & more with Apps ScriptAutomating Google Workspace (GWS) & more with Apps Script
Automating Google Workspace (GWS) & more with Apps Script
 
08448380779 Call Girls In Diplomatic Enclave Women Seeking Men
08448380779 Call Girls In Diplomatic Enclave Women Seeking Men08448380779 Call Girls In Diplomatic Enclave Women Seeking Men
08448380779 Call Girls In Diplomatic Enclave Women Seeking Men
 
Scaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organizationScaling API-first – The story of a global engineering organization
Scaling API-first – The story of a global engineering organization
 
Factors to Consider When Choosing Accounts Payable Services Providers.pptx
Factors to Consider When Choosing Accounts Payable Services Providers.pptxFactors to Consider When Choosing Accounts Payable Services Providers.pptx
Factors to Consider When Choosing Accounts Payable Services Providers.pptx
 
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024
 
The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024
 

Increasingly Accurate Representation of Biochemistry (v2)

  • 1. Increasingly Accurate Representation of Biochemistry (v2) Michel Dumontier , Ph.D. Assistant Professor of Bioinformatics Department of Biology, School of Computer Science Institute of Biochemistry, Ottawa Institute of Systems Biology Carleton University SemWeb Group::Vancouver 21/05/2009
  • 2. Representational Issues Biochemical Identity Accurate Descriptions Precise Identifiers Modeling Situations
  • 3. Which of these are different? # A, B Difference? 1 α -D-Glucose, alpha-D-Glucose None, multiple names 2 α -D-Glucose, β -D-Glucose 3 α -D-Glucose, β -D-Glucose, D-Glucose 4 α -D-Glucose, α -D-Glucose-6-phosphate 5 Hk, Hk(L529S) 6 Hk(human), Hk(mouse) 7 Hk(open), Hk(closed) 8 Hk (L529), Hk (L540) 9 Hk (L529), Hk (A530)
  • 4.
  • 5. α -D-Glucose and β -D-Glucose are more specific types* of D-Glucose * They resolve an ambiguity in stereochemistry
  • 6.
  • 7.
  • 8. Hexokinase (mutation) 50 0 51 0 52 0 53 0 54 0 RRFHKTLRRL VPDSDVRFLL SESGSGKGAA MVTAVAYR S A EQHRQIEETL 50 0 51 0 52 0 53 0 54 0 RRFHKTLRRL VPDSDVRFLL SESGSGKGAA MVTAVAYRLA EQHRQIEETL Leads to hemolytic anemia different sequence = different entity related by some mutation process
  • 9. Hexokinase (human vs mouse) >sp|P19367|HXK1_HUMAN Hexokinase-1 OS=Homo sapiens GN=HK1 PE=1 SV=3 MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTAT VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVH GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGV EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRV LLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD IRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRG IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG AALITAVGVRLRTEASS >sp|P17710|HXK1_MOUSE Hexokinase-1 OS=Mus musculus GN=Hk1 PE=1 SV=2 MGWGAPLLSRMLHGPGQAGETSPVPERQSGSENPASEDRRPLEKQCSHHLYTMGQNCQRG QAVDVEPKIRPPLTEEKIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTASVKML PTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPENIVHGSGS QLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGVEGAD VVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRH IDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGMYMGE LVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETDKEGVQNAKEILTRLGVEPS HDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMHPQYS RRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLSHFRLSKQAL MEVKKKLRSEMEMGLRKETNSRATVKMLPSYVRSIPDGTEHGDFLALDLGGTNFRVLLVK IRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGFTFSF PCKQTSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVGTMMT CAYEEPSCEIGLIVGTGSNACYMEEMKNVEMVEGNQGQMCINMEWGAFGDNGCLDDIRTD FDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFET KFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAAVVQK IRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFLLSEDGSGKGAALI TAVGVRLRGDPTNA
  • 10.
  • 11. Parts need to be identifiable and describable # A, B Difference? 1 α -D-Glucose, alpha-D-Glucose None, multiple names 2 α -D-Glucose, β -D-Glucose Structural (rearrangement) 3 α -D-Glucose, β -D-Glucose, D-Glucose More specific type 4 α -D-Glucose, α -D-Glucose-6-phosphate Structural (modification) 5 Hk, Hk(L529S) Structural (mutation) 6 Hk(human), Hk(mouse) Structural (sequence) 7 Hk(open), Hk(closed) Conformational 8 Hk (L529), Hk (L540) Positional 9 Hk (L529), Hk (A530) Structural, positional
  • 12. Biochemical identity is necessarily based on a description of structure
  • 13. To determine identity, we have compare their descriptions
  • 14. Given A and B How would you know that they are different?
  • 15.
  • 16. Biochemical identity is necessarily based on having accurate descriptions
  • 17. Yet, current approaches add *annotations* rather than create new records with their respective descriptions
  • 18.  
  • 19.
  • 20. Biochemical relationship is necessarily based on a comparison of accurate descriptions
  • 21. For each description, we must assign a unique name or identifier
  • 22. If the description changes we need a new identifier!
  • 23.
  • 24.
  • 25. (S)-Glutamic Acid InChI= {version}1 /{formula}C5H9NO4 /c{connections}6-3(5(9)10)1-2-4(7)8 /h{H_atoms}3H,1-2,6H2,(H,7,8)(H,9,10) /p{protons}+1 /t{stereo:sp3}3- /m{stereo:sp3:inverted}0 /s{stereo:type (1=abs, 2=rel, 3=rac)}1 /i{isotopic:atoms}4+1
  • 26. 2. Accurate Descriptions CML SDF O1[C@@H]([C@@H](O)([C@H](O)([C@@H](O)([C@@H]1(O)))))(CO) 79025 IUPAC InChI=1/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3-,4+,5-,6+/m1/s1 InCHI α -D-Glucose 6-(hydroxymethyl)oxane-2,3,4,5-tetrol OR (2R,3R,4S,5R,6R)-6 -(hydroxymethyl)tetrahydro -2H-pyran-2,3,4,5-tetraol SMILES
  • 27.
  • 28. Chemical Ontology Chemical Knowledge for the Semantic Web. Mykola Konyk ,  Alexander De Leon , and  Michel Dumontier . LNBI . 2008. 5109:169-176.  Data Integration in the Life Sciences (DILS2008) . Evry. France. 
  • 29. RDF/OWL descriptions of molecules http://code.google.com/p/semanticwebopenbabel/
  • 30. Describing chemical functional groups in OWL-DL for the classification of chemical compounds hydroxyl group methyl group Knowledge of functional groups is important in chemical synthesis, pharmaceutical design and lead optimization. Functional groups describe chemical reactivity in terms of atoms and their connectivity, and exhibits characteristic chemical behavior when present in a compound. N Villanueva-Rosales, MDumontier. 2007. OWLED, Innsbruck, Austria. Ethanol
  • 31.
  • 33.
  • 35.
  • 36.
  • 37.
  • 38.
  • 39.
  • 40.
  • 43.
  • 44.
  • 45.
  • 46.
  • 48.
  • 49. We will add new knowledge about biochemicals and their parts into the linked data web through Bio2RDF!
  • 50.
  • 51.
  • 52. dumontierlab.com [email_address] Special thanks to PhD Student Leonid Chepelev for insightful discussions  semanticscience.org

Notas do Editor

  1. <number>
  2. <number>
  3. <number>