SlideShare a Scribd company logo
1 of 27
Download to read offline
Mass Spectrometric Analysis of CYP450s Following
         Mechanism-Based Inactivation

                Luke Lightning, PhD
                Alquest Therapeutics
                 San Francisco, CA

               Genentech Presentation
                     7/11/2012
Outline
•   Brief Introduction
•   LC/MS Analysis of Intact CYP450s
•   Identification of Peptide Adducts
•   Other Studies
•   Conclusions and Future Directions
Known Pathways of CYP450 Mechanism-Based Inactivation


                                        MBI*
                               N
                               Fe           N
                          N
                                   N
                                                        Fe




          MBI
                                       MBI*
                                                              N
     N                        N                     N
     Fe    N                  Fe        N
N                     N                         N                 N
     N                        N                         Cys
Purification and Mass Spectral Analysis of P450s

      MM 1A2 2A6 2C9 2C9 3A4                                P450 2C9
                    C175R
kDa
                                                                             55,578.6 Da
 94
 67

                                           ESI-MS
 43



 30



 20


 • specific contents = 14.3-16.6 nmol/mg            • Charge States = 25
                                                    • Predicted MM = 55,575.1 Da
                                                    • Error = 0.006% (3.5 Da)
Standard Inactivation Experimental Protocol

• CYP450:reductase:cytochrome b5 (various ratios, 1 nmol CYP450)
• 50 mM potassium phosphate buffer
• Dialyze overnight at 4ºC to remove glycerol and/or detergent
• 50 µg DLPC, 2000 U/mL catalase added
• Set on ice for 60 min
• Preincubate at 30ºC for 2 min with inactivator (1% MeOH maximum)
• Initiate reaction with NADPH and incubate for 60 min
• Set on ice until LC/MS/MS analysis of intact protein or incubate with
  protease or CNBr (reaction times vary) for peptide digests
• Can pre-treat the intact protein mixture with denaturants (e.g. Guanidinum
  HCl, urea)
Standard LC/MS/MS Analysis
• HPLC column: Poros R2 perfusion column (4.6 x 100 mm) from Applied
  Biosystems (Cambridge, MA)
• Buffer A – 0.05% TFA (pH 3.0), Buffer B – 0.05% TFA in 95:5% ACN:H2O
• Flow rate: 3 mL/min with 50 µL diverted to the MS
• 300 pmol of spectrally detectable CYP450 or 1 nmol of inactivated CYP450
  and components was injected onto the system
• VG Quattro II triple quad ESI-MS running MassLynx software
• Data acquisition from m/z 200-2000Da

• Improvements with time:
   – Can purchase purified CYP450s, CYP450 reductase, and cytochrome b5
   – Mass spectrometers and software (e.g. SEQUEST)
   – 2.1 x 30 mm columns  lower flow rates, less protein required
CYP450 2B1 + 8-MOP: HPLC Separation

                250
                200                 CYP450 reductase                          CYP2B1
Absorbance
                150
 (214 nm)
                100
                50
                             b5, Heme
                 0
                       0                       Time (min)                    8.0

                  400

                  300                                Binding Stoichiometry
Radioactivity
  (dpm)                                                  = 0.7 ± 0.1
                     200

                     100




                    8-MOP binding is specific for the apoprotein of 2B1
                               short HPLC run time (8-10 min)
          hydrolysis of the label occurs (e.g. HPLC, SDS-PAGE, & enzymatic digest)
                                                   Biochemistry 37, 13184-13193 (1998)
Methods in Enzymology, Volume 357, page 296-300 (2002)
Mechanism-based Inactivators of CYP450s


  8-MOP                                                             2A6 & 2B1
                            O           O          O
                                     OCH3


                                O
                        S
                                                                                    X
                                                                      2C9
Tienilic Acid                   Cl                                              O
                                               OCH2COOH
                                         Cl

                                                                                Nu:
                                                                                CYP450
                                N             OH               OH     3A4
 L-754,394                                                 H
                O                    N                     N
                    N
                                O                      O
                                     NH
CYP2C9 + Tienilic Acid

                                                                         Monoadduct
                    55,578.6 Da                                            (+) 344 ± 1

                                                                  2C9     Diadduct
 CYP2C9                                                                     (+) 694 ± 4




                      +                    (+) GSH
                                                                   2C9   monoadduct
                      O
                S
Tienilic Acid
                     Cl            OCH2COOH
                            Cl

         (+) 344 and (+) 694 Da correlate w/ addition of TA-OH to 2C9
             suggested thiophene epoxide mechanism is operative
                                                     Biochemistry 38, 2312-2319 (1999)
CYP2B1 + 8-MOP: LC/MS Analysis

      CYP2B1                                   CYP2B1/8-MOP + CYP2B1

                                                                         56,163.6 Da
                  55,925.7 Da
                                                              CYP2B1

                                + 8-MOP




• predicted = 56,933.8 Da                   •  = 237.9 Da (furanoepoxide = 234.2 Da)
• error = 8.1 Da (0.01%)                    • similar results obtained with CYP450 2A6

                                          Biochemistry 37, 10047-10061 (1998)
Methods in Enzymology, Volume 357, page 296-300 (2002)
MM    2B1 +    MM
                                                          kDa        8-MOP           kDa
                                                          200
        8-MOP                CYP2B1-8-MOP                 116
                                                           97
                                                           66
         N                                                 55
    N    Fe N
         N                                                37
                                                          31
                                                          22
                      CNBr                                                           17
                                                          14                         14
                                                                                     11
                                                                                      8
                                                           6
                                                          3.5
                                                          2.5
                                                                              Radioactivity
           800                        CNBr Peptide

            600
Radioactivity
  (dpm) 400

           200
                                                                       MALDI-MS
             0
                  0    10        20         30       40
                               Time (min)
MALDI-MS: CYP2B1 + 8-MOP

         35000
                                             2722.1
         30000
         25000
Counts
         20000
         15000
         10000
          5000
            0
                 2500   2600      2700           2800   2900   3000

                                 Mass (m/z)


     2721.9 ± 0.1        290-ISLLSLFFAGTETSSTTLRYGFLLM-314 (2721.2 Da)
                               SRS-4 (I helix)
CYP2B1 + 8-MOP




                 8-MOP
CYP3A4 + L-754,394




                                       SDS-PAGE

                                       HPLC       MALDI-MS
Biochemistry 39, 4276-4287 (1999)
MALDI-MS: CYP3A4 + L-754,394

         4000
                                                      4705.2
         3000
Counts
         2000

         1000

           0


                4000          4300         4600        4900          5200      5500
                                          Mass (m/z)

    4704.2 ± 1.0

                       275-IDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIM-317 (4703.2 Da)
                                                        SRS-4 (I-helix)
CYP3A4 + Raloxifene
raloxifene-
                                      adducted
PIA adducted CYP3A4
                                      peptide,
    (Cys-reacting)                    237-NICVFPR-243.

                                             Cys239

                      No radiolabel              MS2
                       adducted
                        peptide
                          from
                      proteinase K
                         digest


                                                 MS3
Cys239




3




    peptide from tryptic digest


    Tyrosine 75
2011
2011
           CYP2B6

           CYP2B6 +
           clopidogrel

           CYP2B6+
          clopidogrel+
              DTT
Other studies
2004




                2005




                       2006
Other studies
 2010




         2011




                2012
Conclusions
• LC/MS analyses of intact CYP450s is possible
  – Short run times, accurate


• Adducted intact proteins and peptide adducts can be
  identified without use of a radiolabeled molecule
Future Directions?
• Crystal structures of adducted proteins
• Proteomic analysis and scanning for adducts?
   – Microsomes, hepatocytes
   – Supersomes
   – Labeled compounds or isotope labeled proteins
   – Affinity purification techniques
   – Potential issues with ESI
      • Amount of protein required  clogging of columns
      • Stability of adducts to workup conditions
   – MALDI
Future Directions – MALDI?




• Tumor specific protein signals
         were detected
  • Proteomic information was
           extracted

       • Try with HLMs
Thank you!!

             Luke Lightning, PhD
             Alquest Therapeutics
             llightning@alquest.us

   http://www.meetup.com/BayAreaLifeTech/
Next event: Happy Hour in SF, Thursday 7/12/2012

More Related Content

What's hot

Structure-Function Relationships in the MppP Family
Structure-Function Relationships in the MppP FamilyStructure-Function Relationships in the MppP Family
Structure-Function Relationships in the MppP FamilyOURUWM
 
Final Report Daad13 02 C 0015 Part5 App G K
Final Report Daad13 02 C 0015 Part5 App G KFinal Report Daad13 02 C 0015 Part5 App G K
Final Report Daad13 02 C 0015 Part5 App G Kinscore
 
Fireflies & superbugs: when science & nature collide
Fireflies & superbugs: when science & nature collideFireflies & superbugs: when science & nature collide
Fireflies & superbugs: when science & nature collideSiouxsie Wiles
 
Acs 2010 San Fransico
Acs 2010 San FransicoAcs 2010 San Fransico
Acs 2010 San FransicoKaren Sanders
 
Cell respiration part 2
Cell respiration part 2Cell respiration part 2
Cell respiration part 2Maria Donohue
 
ultra voilet chemical derivatisation
ultra voilet chemical derivatisationultra voilet chemical derivatisation
ultra voilet chemical derivatisationSurbhi Narang
 
Nucleotide METABOLISM MUHAMMAD MUSTANSAR
Nucleotide  METABOLISM  MUHAMMAD MUSTANSARNucleotide  METABOLISM  MUHAMMAD MUSTANSAR
Nucleotide METABOLISM MUHAMMAD MUSTANSARDr Muhammad Mustansar
 
Oral presentation
Oral presentationOral presentation
Oral presentationAnh-Mai
 
Internship oral presentation
Internship oral presentationInternship oral presentation
Internship oral presentationAnh-Mai
 
Photosynthesis with turning point qs ppt
Photosynthesis with turning point qs pptPhotosynthesis with turning point qs ppt
Photosynthesis with turning point qs ppttas11244
 

What's hot (14)

Structure-Function Relationships in the MppP Family
Structure-Function Relationships in the MppP FamilyStructure-Function Relationships in the MppP Family
Structure-Function Relationships in the MppP Family
 
Final Report Daad13 02 C 0015 Part5 App G K
Final Report Daad13 02 C 0015 Part5 App G KFinal Report Daad13 02 C 0015 Part5 App G K
Final Report Daad13 02 C 0015 Part5 App G K
 
Fireflies & superbugs: when science & nature collide
Fireflies & superbugs: when science & nature collideFireflies & superbugs: when science & nature collide
Fireflies & superbugs: when science & nature collide
 
Acs 2010 San Fransico
Acs 2010 San FransicoAcs 2010 San Fransico
Acs 2010 San Fransico
 
Respiration
RespirationRespiration
Respiration
 
K0347480 copy
K0347480   copyK0347480   copy
K0347480 copy
 
Cell respiration part 2
Cell respiration part 2Cell respiration part 2
Cell respiration part 2
 
ultra voilet chemical derivatisation
ultra voilet chemical derivatisationultra voilet chemical derivatisation
ultra voilet chemical derivatisation
 
Nucleotide METABOLISM MUHAMMAD MUSTANSAR
Nucleotide  METABOLISM  MUHAMMAD MUSTANSARNucleotide  METABOLISM  MUHAMMAD MUSTANSAR
Nucleotide METABOLISM MUHAMMAD MUSTANSAR
 
Oral presentation
Oral presentationOral presentation
Oral presentation
 
Lipid.pptx 0
Lipid.pptx 0Lipid.pptx 0
Lipid.pptx 0
 
Internship oral presentation
Internship oral presentationInternship oral presentation
Internship oral presentation
 
Types chrom
Types chromTypes chrom
Types chrom
 
Photosynthesis with turning point qs ppt
Photosynthesis with turning point qs pptPhotosynthesis with turning point qs ppt
Photosynthesis with turning point qs ppt
 

Similar to Mass spectrometric analysis of cyp450s following mechanism based inactivation Lightning 2012

Carbohydrate solutions 40 min
Carbohydrate solutions 40 minCarbohydrate solutions 40 min
Carbohydrate solutions 40 minOskari Aro
 
Application of ICP-MS and LC-ICP-MS in Drug Development
Application of ICP-MS and LC-ICP-MS in Drug DevelopmentApplication of ICP-MS and LC-ICP-MS in Drug Development
Application of ICP-MS and LC-ICP-MS in Drug DevelopmentQPS Holdings, LLC
 
Metabolite_Identification_by_LCMS
Metabolite_Identification_by_LCMSMetabolite_Identification_by_LCMS
Metabolite_Identification_by_LCMSshiva gudlawar
 
Thesis presentation gm dt480.4 p
Thesis presentation gm dt480.4 pThesis presentation gm dt480.4 p
Thesis presentation gm dt480.4 pGavinMDublin
 
Photorespiration
PhotorespirationPhotorespiration
PhotorespirationAlj Millano
 
postertemplate_plc_v36_final2
postertemplate_plc_v36_final2postertemplate_plc_v36_final2
postertemplate_plc_v36_final2Patrick Cavins
 
Are we there yet
Are we there yetAre we there yet
Are we there yetmasesane
 
Hipoperfusao oculta
Hipoperfusao oculta Hipoperfusao oculta
Hipoperfusao oculta wruivo
 
Cellular respiration 2012
Cellular respiration 2012Cellular respiration 2012
Cellular respiration 2012Carla
 
Lessons learned from injecting liquid activated carbon suspension
Lessons learned from injecting liquid activated carbon suspensionLessons learned from injecting liquid activated carbon suspension
Lessons learned from injecting liquid activated carbon suspensionAntea Group
 
Polymeric nanoparticles for encapsulation and controlled release of bioactive...
Polymeric nanoparticles for encapsulation and controlled release of bioactive...Polymeric nanoparticles for encapsulation and controlled release of bioactive...
Polymeric nanoparticles for encapsulation and controlled release of bioactive...Tomsk Polytechnic University
 
Lecture_Chapter_3.pdfgjfyjvgygjjuffjjjvgh
Lecture_Chapter_3.pdfgjfyjvgygjjuffjjjvghLecture_Chapter_3.pdfgjfyjvgygjjuffjjjvgh
Lecture_Chapter_3.pdfgjfyjvgygjjuffjjjvghQueen527100
 
Interpretation of the Arterial Blood Gas analysis
Interpretation of the Arterial Blood Gas analysisInterpretation of the Arterial Blood Gas analysis
Interpretation of the Arterial Blood Gas analysisVishal Golay
 
NaI:Tl-based radiation detector with improved light output and energy resolution
NaI:Tl-based radiation detector with improved light output and energy resolutionNaI:Tl-based radiation detector with improved light output and energy resolution
NaI:Tl-based radiation detector with improved light output and energy resolutionLawrence Berkeley National Laboratory
 
A fast and accurate computational approach to protein ionization: combining t...
A fast and accurate computational approach to protein ionization: combining t...A fast and accurate computational approach to protein ionization: combining t...
A fast and accurate computational approach to protein ionization: combining t...BIOVIA
 
การหายใจระดับเซลล์
การหายใจระดับเซลล์การหายใจระดับเซลล์
การหายใจระดับเซลล์PANUWAT TANGPUNCHAROEN
 
System response of metabolic networks in Chlamydomonas reinhardtii during Nit...
System response of metabolic networks in Chlamydomonas reinhardtii during Nit...System response of metabolic networks in Chlamydomonas reinhardtii during Nit...
System response of metabolic networks in Chlamydomonas reinhardtii during Nit...Nishikant Wase
 
High chloride in PLS and their impact on Copper solvent extraction
High chloride in PLS and their impact on Copper solvent extractionHigh chloride in PLS and their impact on Copper solvent extraction
High chloride in PLS and their impact on Copper solvent extractionBASF
 

Similar to Mass spectrometric analysis of cyp450s following mechanism based inactivation Lightning 2012 (20)

Carbohydrate solutions 40 min
Carbohydrate solutions 40 minCarbohydrate solutions 40 min
Carbohydrate solutions 40 min
 
Application of ICP-MS and LC-ICP-MS in Drug Development
Application of ICP-MS and LC-ICP-MS in Drug DevelopmentApplication of ICP-MS and LC-ICP-MS in Drug Development
Application of ICP-MS and LC-ICP-MS in Drug Development
 
Metabolite_Identification_by_LCMS
Metabolite_Identification_by_LCMSMetabolite_Identification_by_LCMS
Metabolite_Identification_by_LCMS
 
Thesis presentation gm dt480.4 p
Thesis presentation gm dt480.4 pThesis presentation gm dt480.4 p
Thesis presentation gm dt480.4 p
 
Photorespiration
PhotorespirationPhotorespiration
Photorespiration
 
postertemplate_plc_v36_final2
postertemplate_plc_v36_final2postertemplate_plc_v36_final2
postertemplate_plc_v36_final2
 
Are we there yet
Are we there yetAre we there yet
Are we there yet
 
Hipoperfusao oculta
Hipoperfusao oculta Hipoperfusao oculta
Hipoperfusao oculta
 
Cellular respiration 2012
Cellular respiration 2012Cellular respiration 2012
Cellular respiration 2012
 
Cadd
CaddCadd
Cadd
 
Lessons learned from injecting liquid activated carbon suspension
Lessons learned from injecting liquid activated carbon suspensionLessons learned from injecting liquid activated carbon suspension
Lessons learned from injecting liquid activated carbon suspension
 
Water Analysis using LAMBDA
Water Analysis using LAMBDAWater Analysis using LAMBDA
Water Analysis using LAMBDA
 
Polymeric nanoparticles for encapsulation and controlled release of bioactive...
Polymeric nanoparticles for encapsulation and controlled release of bioactive...Polymeric nanoparticles for encapsulation and controlled release of bioactive...
Polymeric nanoparticles for encapsulation and controlled release of bioactive...
 
Lecture_Chapter_3.pdfgjfyjvgygjjuffjjjvgh
Lecture_Chapter_3.pdfgjfyjvgygjjuffjjjvghLecture_Chapter_3.pdfgjfyjvgygjjuffjjjvgh
Lecture_Chapter_3.pdfgjfyjvgygjjuffjjjvgh
 
Interpretation of the Arterial Blood Gas analysis
Interpretation of the Arterial Blood Gas analysisInterpretation of the Arterial Blood Gas analysis
Interpretation of the Arterial Blood Gas analysis
 
NaI:Tl-based radiation detector with improved light output and energy resolution
NaI:Tl-based radiation detector with improved light output and energy resolutionNaI:Tl-based radiation detector with improved light output and energy resolution
NaI:Tl-based radiation detector with improved light output and energy resolution
 
A fast and accurate computational approach to protein ionization: combining t...
A fast and accurate computational approach to protein ionization: combining t...A fast and accurate computational approach to protein ionization: combining t...
A fast and accurate computational approach to protein ionization: combining t...
 
การหายใจระดับเซลล์
การหายใจระดับเซลล์การหายใจระดับเซลล์
การหายใจระดับเซลล์
 
System response of metabolic networks in Chlamydomonas reinhardtii during Nit...
System response of metabolic networks in Chlamydomonas reinhardtii during Nit...System response of metabolic networks in Chlamydomonas reinhardtii during Nit...
System response of metabolic networks in Chlamydomonas reinhardtii during Nit...
 
High chloride in PLS and their impact on Copper solvent extraction
High chloride in PLS and their impact on Copper solvent extractionHigh chloride in PLS and their impact on Copper solvent extraction
High chloride in PLS and their impact on Copper solvent extraction
 

More from Luke Lightning

Human esterases: Chemical and Biochemical Considerations
Human esterases: Chemical and Biochemical ConsiderationsHuman esterases: Chemical and Biochemical Considerations
Human esterases: Chemical and Biochemical ConsiderationsLuke Lightning
 
Hydrolysis of pyrethroids by human and rat tissues
Hydrolysis of pyrethroids by human and rat tissuesHydrolysis of pyrethroids by human and rat tissues
Hydrolysis of pyrethroids by human and rat tissuesLuke Lightning
 
Lightning Deloitte Patheon QB3 Talk 2012
Lightning Deloitte Patheon QB3 Talk 2012Lightning Deloitte Patheon QB3 Talk 2012
Lightning Deloitte Patheon QB3 Talk 2012Luke Lightning
 
CYP2C9 Haplotype Structure and Association with Clinical Outcomes
CYP2C9 Haplotype Structure and Association with Clinical OutcomesCYP2C9 Haplotype Structure and Association with Clinical Outcomes
CYP2C9 Haplotype Structure and Association with Clinical OutcomesLuke Lightning
 
Butyrylcholinesterase Overview: Substrates Inhibitors Structure Mechanism The...
Butyrylcholinesterase Overview: Substrates Inhibitors Structure Mechanism The...Butyrylcholinesterase Overview: Substrates Inhibitors Structure Mechanism The...
Butyrylcholinesterase Overview: Substrates Inhibitors Structure Mechanism The...Luke Lightning
 
Involvement of multiple P450s and UDP-GTs in the in vitro metabolism of Murag...
Involvement of multiple P450s and UDP-GTs in the in vitro metabolism of Murag...Involvement of multiple P450s and UDP-GTs in the in vitro metabolism of Murag...
Involvement of multiple P450s and UDP-GTs in the in vitro metabolism of Murag...Luke Lightning
 
Microscale culture of human liver cells for drug development
Microscale culture of human liver cells for drug developmentMicroscale culture of human liver cells for drug development
Microscale culture of human liver cells for drug developmentLuke Lightning
 
Introduction to pharmacology and drug metabolism
Introduction to pharmacology and drug metabolismIntroduction to pharmacology and drug metabolism
Introduction to pharmacology and drug metabolismLuke Lightning
 
Osteoporosis Therapy Overview
Osteoporosis Therapy OverviewOsteoporosis Therapy Overview
Osteoporosis Therapy OverviewLuke Lightning
 
Molecular analysis of whole body animal tissue secitions by imaging maldi ms
Molecular analysis of whole body animal tissue secitions by imaging maldi msMolecular analysis of whole body animal tissue secitions by imaging maldi ms
Molecular analysis of whole body animal tissue secitions by imaging maldi msLuke Lightning
 
Kinetics of glyburide metabolism by humans and baboons using liver and placen...
Kinetics of glyburide metabolism by humans and baboons using liver and placen...Kinetics of glyburide metabolism by humans and baboons using liver and placen...
Kinetics of glyburide metabolism by humans and baboons using liver and placen...Luke Lightning
 

More from Luke Lightning (11)

Human esterases: Chemical and Biochemical Considerations
Human esterases: Chemical and Biochemical ConsiderationsHuman esterases: Chemical and Biochemical Considerations
Human esterases: Chemical and Biochemical Considerations
 
Hydrolysis of pyrethroids by human and rat tissues
Hydrolysis of pyrethroids by human and rat tissuesHydrolysis of pyrethroids by human and rat tissues
Hydrolysis of pyrethroids by human and rat tissues
 
Lightning Deloitte Patheon QB3 Talk 2012
Lightning Deloitte Patheon QB3 Talk 2012Lightning Deloitte Patheon QB3 Talk 2012
Lightning Deloitte Patheon QB3 Talk 2012
 
CYP2C9 Haplotype Structure and Association with Clinical Outcomes
CYP2C9 Haplotype Structure and Association with Clinical OutcomesCYP2C9 Haplotype Structure and Association with Clinical Outcomes
CYP2C9 Haplotype Structure and Association with Clinical Outcomes
 
Butyrylcholinesterase Overview: Substrates Inhibitors Structure Mechanism The...
Butyrylcholinesterase Overview: Substrates Inhibitors Structure Mechanism The...Butyrylcholinesterase Overview: Substrates Inhibitors Structure Mechanism The...
Butyrylcholinesterase Overview: Substrates Inhibitors Structure Mechanism The...
 
Involvement of multiple P450s and UDP-GTs in the in vitro metabolism of Murag...
Involvement of multiple P450s and UDP-GTs in the in vitro metabolism of Murag...Involvement of multiple P450s and UDP-GTs in the in vitro metabolism of Murag...
Involvement of multiple P450s and UDP-GTs in the in vitro metabolism of Murag...
 
Microscale culture of human liver cells for drug development
Microscale culture of human liver cells for drug developmentMicroscale culture of human liver cells for drug development
Microscale culture of human liver cells for drug development
 
Introduction to pharmacology and drug metabolism
Introduction to pharmacology and drug metabolismIntroduction to pharmacology and drug metabolism
Introduction to pharmacology and drug metabolism
 
Osteoporosis Therapy Overview
Osteoporosis Therapy OverviewOsteoporosis Therapy Overview
Osteoporosis Therapy Overview
 
Molecular analysis of whole body animal tissue secitions by imaging maldi ms
Molecular analysis of whole body animal tissue secitions by imaging maldi msMolecular analysis of whole body animal tissue secitions by imaging maldi ms
Molecular analysis of whole body animal tissue secitions by imaging maldi ms
 
Kinetics of glyburide metabolism by humans and baboons using liver and placen...
Kinetics of glyburide metabolism by humans and baboons using liver and placen...Kinetics of glyburide metabolism by humans and baboons using liver and placen...
Kinetics of glyburide metabolism by humans and baboons using liver and placen...
 

Recently uploaded

4. Cobus Valentine- Cybersecurity Threats and Solutions for the Public Sector
4. Cobus Valentine- Cybersecurity Threats and Solutions for the Public Sector4. Cobus Valentine- Cybersecurity Threats and Solutions for the Public Sector
4. Cobus Valentine- Cybersecurity Threats and Solutions for the Public Sectoritnewsafrica
 
Transcript: New from BookNet Canada for 2024: BNC SalesData and LibraryData -...
Transcript: New from BookNet Canada for 2024: BNC SalesData and LibraryData -...Transcript: New from BookNet Canada for 2024: BNC SalesData and LibraryData -...
Transcript: New from BookNet Canada for 2024: BNC SalesData and LibraryData -...BookNet Canada
 
Microsoft 365 Copilot: How to boost your productivity with AI – Part one: Ado...
Microsoft 365 Copilot: How to boost your productivity with AI – Part one: Ado...Microsoft 365 Copilot: How to boost your productivity with AI – Part one: Ado...
Microsoft 365 Copilot: How to boost your productivity with AI – Part one: Ado...Nikki Chapple
 
A Journey Into the Emotions of Software Developers
A Journey Into the Emotions of Software DevelopersA Journey Into the Emotions of Software Developers
A Journey Into the Emotions of Software DevelopersNicole Novielli
 
Unleashing Real-time Insights with ClickHouse_ Navigating the Landscape in 20...
Unleashing Real-time Insights with ClickHouse_ Navigating the Landscape in 20...Unleashing Real-time Insights with ClickHouse_ Navigating the Landscape in 20...
Unleashing Real-time Insights with ClickHouse_ Navigating the Landscape in 20...Alkin Tezuysal
 
How to Effectively Monitor SD-WAN and SASE Environments with ThousandEyes
How to Effectively Monitor SD-WAN and SASE Environments with ThousandEyesHow to Effectively Monitor SD-WAN and SASE Environments with ThousandEyes
How to Effectively Monitor SD-WAN and SASE Environments with ThousandEyesThousandEyes
 
MuleSoft Online Meetup Group - B2B Crash Course: Release SparkNotes
MuleSoft Online Meetup Group - B2B Crash Course: Release SparkNotesMuleSoft Online Meetup Group - B2B Crash Course: Release SparkNotes
MuleSoft Online Meetup Group - B2B Crash Course: Release SparkNotesManik S Magar
 
Abdul Kader Baba- Managing Cybersecurity Risks and Compliance Requirements i...
Abdul Kader Baba- Managing Cybersecurity Risks  and Compliance Requirements i...Abdul Kader Baba- Managing Cybersecurity Risks  and Compliance Requirements i...
Abdul Kader Baba- Managing Cybersecurity Risks and Compliance Requirements i...itnewsafrica
 
Decarbonising Buildings: Making a net-zero built environment a reality
Decarbonising Buildings: Making a net-zero built environment a realityDecarbonising Buildings: Making a net-zero built environment a reality
Decarbonising Buildings: Making a net-zero built environment a realityIES VE
 
Microservices, Docker deploy and Microservices source code in C#
Microservices, Docker deploy and Microservices source code in C#Microservices, Docker deploy and Microservices source code in C#
Microservices, Docker deploy and Microservices source code in C#Karmanjay Verma
 
[Webinar] SpiraTest - Setting New Standards in Quality Assurance
[Webinar] SpiraTest - Setting New Standards in Quality Assurance[Webinar] SpiraTest - Setting New Standards in Quality Assurance
[Webinar] SpiraTest - Setting New Standards in Quality AssuranceInflectra
 
Long journey of Ruby standard library at RubyConf AU 2024
Long journey of Ruby standard library at RubyConf AU 2024Long journey of Ruby standard library at RubyConf AU 2024
Long journey of Ruby standard library at RubyConf AU 2024Hiroshi SHIBATA
 
Top 10 Hubspot Development Companies in 2024
Top 10 Hubspot Development Companies in 2024Top 10 Hubspot Development Companies in 2024
Top 10 Hubspot Development Companies in 2024TopCSSGallery
 
Kuma Meshes Part I - The basics - A tutorial
Kuma Meshes Part I - The basics - A tutorialKuma Meshes Part I - The basics - A tutorial
Kuma Meshes Part I - The basics - A tutorialJoão Esperancinha
 
Potential of AI (Generative AI) in Business: Learnings and Insights
Potential of AI (Generative AI) in Business: Learnings and InsightsPotential of AI (Generative AI) in Business: Learnings and Insights
Potential of AI (Generative AI) in Business: Learnings and InsightsRavi Sanghani
 
Assure Ecommerce and Retail Operations Uptime with ThousandEyes
Assure Ecommerce and Retail Operations Uptime with ThousandEyesAssure Ecommerce and Retail Operations Uptime with ThousandEyes
Assure Ecommerce and Retail Operations Uptime with ThousandEyesThousandEyes
 
Email Marketing Automation for Bonterra Impact Management (fka Social Solutio...
Email Marketing Automation for Bonterra Impact Management (fka Social Solutio...Email Marketing Automation for Bonterra Impact Management (fka Social Solutio...
Email Marketing Automation for Bonterra Impact Management (fka Social Solutio...Jeffrey Haguewood
 
Glenn Lazarus- Why Your Observability Strategy Needs Security Observability
Glenn Lazarus- Why Your Observability Strategy Needs Security ObservabilityGlenn Lazarus- Why Your Observability Strategy Needs Security Observability
Glenn Lazarus- Why Your Observability Strategy Needs Security Observabilityitnewsafrica
 
Digital Tools & AI in Career Development
Digital Tools & AI in Career DevelopmentDigital Tools & AI in Career Development
Digital Tools & AI in Career DevelopmentMahmoud Rabie
 
JET Technology Labs White Paper for Virtualized Security and Encryption Techn...
JET Technology Labs White Paper for Virtualized Security and Encryption Techn...JET Technology Labs White Paper for Virtualized Security and Encryption Techn...
JET Technology Labs White Paper for Virtualized Security and Encryption Techn...amber724300
 

Recently uploaded (20)

4. Cobus Valentine- Cybersecurity Threats and Solutions for the Public Sector
4. Cobus Valentine- Cybersecurity Threats and Solutions for the Public Sector4. Cobus Valentine- Cybersecurity Threats and Solutions for the Public Sector
4. Cobus Valentine- Cybersecurity Threats and Solutions for the Public Sector
 
Transcript: New from BookNet Canada for 2024: BNC SalesData and LibraryData -...
Transcript: New from BookNet Canada for 2024: BNC SalesData and LibraryData -...Transcript: New from BookNet Canada for 2024: BNC SalesData and LibraryData -...
Transcript: New from BookNet Canada for 2024: BNC SalesData and LibraryData -...
 
Microsoft 365 Copilot: How to boost your productivity with AI – Part one: Ado...
Microsoft 365 Copilot: How to boost your productivity with AI – Part one: Ado...Microsoft 365 Copilot: How to boost your productivity with AI – Part one: Ado...
Microsoft 365 Copilot: How to boost your productivity with AI – Part one: Ado...
 
A Journey Into the Emotions of Software Developers
A Journey Into the Emotions of Software DevelopersA Journey Into the Emotions of Software Developers
A Journey Into the Emotions of Software Developers
 
Unleashing Real-time Insights with ClickHouse_ Navigating the Landscape in 20...
Unleashing Real-time Insights with ClickHouse_ Navigating the Landscape in 20...Unleashing Real-time Insights with ClickHouse_ Navigating the Landscape in 20...
Unleashing Real-time Insights with ClickHouse_ Navigating the Landscape in 20...
 
How to Effectively Monitor SD-WAN and SASE Environments with ThousandEyes
How to Effectively Monitor SD-WAN and SASE Environments with ThousandEyesHow to Effectively Monitor SD-WAN and SASE Environments with ThousandEyes
How to Effectively Monitor SD-WAN and SASE Environments with ThousandEyes
 
MuleSoft Online Meetup Group - B2B Crash Course: Release SparkNotes
MuleSoft Online Meetup Group - B2B Crash Course: Release SparkNotesMuleSoft Online Meetup Group - B2B Crash Course: Release SparkNotes
MuleSoft Online Meetup Group - B2B Crash Course: Release SparkNotes
 
Abdul Kader Baba- Managing Cybersecurity Risks and Compliance Requirements i...
Abdul Kader Baba- Managing Cybersecurity Risks  and Compliance Requirements i...Abdul Kader Baba- Managing Cybersecurity Risks  and Compliance Requirements i...
Abdul Kader Baba- Managing Cybersecurity Risks and Compliance Requirements i...
 
Decarbonising Buildings: Making a net-zero built environment a reality
Decarbonising Buildings: Making a net-zero built environment a realityDecarbonising Buildings: Making a net-zero built environment a reality
Decarbonising Buildings: Making a net-zero built environment a reality
 
Microservices, Docker deploy and Microservices source code in C#
Microservices, Docker deploy and Microservices source code in C#Microservices, Docker deploy and Microservices source code in C#
Microservices, Docker deploy and Microservices source code in C#
 
[Webinar] SpiraTest - Setting New Standards in Quality Assurance
[Webinar] SpiraTest - Setting New Standards in Quality Assurance[Webinar] SpiraTest - Setting New Standards in Quality Assurance
[Webinar] SpiraTest - Setting New Standards in Quality Assurance
 
Long journey of Ruby standard library at RubyConf AU 2024
Long journey of Ruby standard library at RubyConf AU 2024Long journey of Ruby standard library at RubyConf AU 2024
Long journey of Ruby standard library at RubyConf AU 2024
 
Top 10 Hubspot Development Companies in 2024
Top 10 Hubspot Development Companies in 2024Top 10 Hubspot Development Companies in 2024
Top 10 Hubspot Development Companies in 2024
 
Kuma Meshes Part I - The basics - A tutorial
Kuma Meshes Part I - The basics - A tutorialKuma Meshes Part I - The basics - A tutorial
Kuma Meshes Part I - The basics - A tutorial
 
Potential of AI (Generative AI) in Business: Learnings and Insights
Potential of AI (Generative AI) in Business: Learnings and InsightsPotential of AI (Generative AI) in Business: Learnings and Insights
Potential of AI (Generative AI) in Business: Learnings and Insights
 
Assure Ecommerce and Retail Operations Uptime with ThousandEyes
Assure Ecommerce and Retail Operations Uptime with ThousandEyesAssure Ecommerce and Retail Operations Uptime with ThousandEyes
Assure Ecommerce and Retail Operations Uptime with ThousandEyes
 
Email Marketing Automation for Bonterra Impact Management (fka Social Solutio...
Email Marketing Automation for Bonterra Impact Management (fka Social Solutio...Email Marketing Automation for Bonterra Impact Management (fka Social Solutio...
Email Marketing Automation for Bonterra Impact Management (fka Social Solutio...
 
Glenn Lazarus- Why Your Observability Strategy Needs Security Observability
Glenn Lazarus- Why Your Observability Strategy Needs Security ObservabilityGlenn Lazarus- Why Your Observability Strategy Needs Security Observability
Glenn Lazarus- Why Your Observability Strategy Needs Security Observability
 
Digital Tools & AI in Career Development
Digital Tools & AI in Career DevelopmentDigital Tools & AI in Career Development
Digital Tools & AI in Career Development
 
JET Technology Labs White Paper for Virtualized Security and Encryption Techn...
JET Technology Labs White Paper for Virtualized Security and Encryption Techn...JET Technology Labs White Paper for Virtualized Security and Encryption Techn...
JET Technology Labs White Paper for Virtualized Security and Encryption Techn...
 

Mass spectrometric analysis of cyp450s following mechanism based inactivation Lightning 2012

  • 1. Mass Spectrometric Analysis of CYP450s Following Mechanism-Based Inactivation Luke Lightning, PhD Alquest Therapeutics San Francisco, CA Genentech Presentation 7/11/2012
  • 2. Outline • Brief Introduction • LC/MS Analysis of Intact CYP450s • Identification of Peptide Adducts • Other Studies • Conclusions and Future Directions
  • 3. Known Pathways of CYP450 Mechanism-Based Inactivation MBI* N Fe N N N Fe MBI MBI* N N N N Fe N Fe N N N N N N N Cys
  • 4. Purification and Mass Spectral Analysis of P450s MM 1A2 2A6 2C9 2C9 3A4 P450 2C9 C175R kDa 55,578.6 Da 94 67 ESI-MS 43 30 20 • specific contents = 14.3-16.6 nmol/mg • Charge States = 25 • Predicted MM = 55,575.1 Da • Error = 0.006% (3.5 Da)
  • 5. Standard Inactivation Experimental Protocol • CYP450:reductase:cytochrome b5 (various ratios, 1 nmol CYP450) • 50 mM potassium phosphate buffer • Dialyze overnight at 4ºC to remove glycerol and/or detergent • 50 µg DLPC, 2000 U/mL catalase added • Set on ice for 60 min • Preincubate at 30ºC for 2 min with inactivator (1% MeOH maximum) • Initiate reaction with NADPH and incubate for 60 min • Set on ice until LC/MS/MS analysis of intact protein or incubate with protease or CNBr (reaction times vary) for peptide digests • Can pre-treat the intact protein mixture with denaturants (e.g. Guanidinum HCl, urea)
  • 6. Standard LC/MS/MS Analysis • HPLC column: Poros R2 perfusion column (4.6 x 100 mm) from Applied Biosystems (Cambridge, MA) • Buffer A – 0.05% TFA (pH 3.0), Buffer B – 0.05% TFA in 95:5% ACN:H2O • Flow rate: 3 mL/min with 50 µL diverted to the MS • 300 pmol of spectrally detectable CYP450 or 1 nmol of inactivated CYP450 and components was injected onto the system • VG Quattro II triple quad ESI-MS running MassLynx software • Data acquisition from m/z 200-2000Da • Improvements with time: – Can purchase purified CYP450s, CYP450 reductase, and cytochrome b5 – Mass spectrometers and software (e.g. SEQUEST) – 2.1 x 30 mm columns  lower flow rates, less protein required
  • 7. CYP450 2B1 + 8-MOP: HPLC Separation 250 200 CYP450 reductase CYP2B1 Absorbance 150 (214 nm) 100 50 b5, Heme 0 0 Time (min) 8.0 400 300 Binding Stoichiometry Radioactivity (dpm) = 0.7 ± 0.1 200 100  8-MOP binding is specific for the apoprotein of 2B1 short HPLC run time (8-10 min)  hydrolysis of the label occurs (e.g. HPLC, SDS-PAGE, & enzymatic digest) Biochemistry 37, 13184-13193 (1998)
  • 8. Methods in Enzymology, Volume 357, page 296-300 (2002)
  • 9. Mechanism-based Inactivators of CYP450s 8-MOP 2A6 & 2B1 O O O OCH3 O S X 2C9 Tienilic Acid Cl O OCH2COOH Cl Nu: CYP450 N OH OH 3A4 L-754,394 H O N N N O O NH
  • 10. CYP2C9 + Tienilic Acid Monoadduct 55,578.6 Da (+) 344 ± 1 2C9 Diadduct CYP2C9 (+) 694 ± 4 + (+) GSH 2C9 monoadduct O S Tienilic Acid Cl OCH2COOH Cl  (+) 344 and (+) 694 Da correlate w/ addition of TA-OH to 2C9  suggested thiophene epoxide mechanism is operative Biochemistry 38, 2312-2319 (1999)
  • 11. CYP2B1 + 8-MOP: LC/MS Analysis CYP2B1 CYP2B1/8-MOP + CYP2B1 56,163.6 Da 55,925.7 Da CYP2B1 + 8-MOP • predicted = 56,933.8 Da •  = 237.9 Da (furanoepoxide = 234.2 Da) • error = 8.1 Da (0.01%) • similar results obtained with CYP450 2A6 Biochemistry 37, 10047-10061 (1998)
  • 12. Methods in Enzymology, Volume 357, page 296-300 (2002)
  • 13. MM 2B1 + MM kDa 8-MOP kDa 200 8-MOP CYP2B1-8-MOP 116 97 66 N 55 N Fe N N 37 31 22 CNBr 17 14 14 11 8 6 3.5 2.5 Radioactivity 800 CNBr Peptide 600 Radioactivity (dpm) 400 200 MALDI-MS 0 0 10 20 30 40 Time (min)
  • 14. MALDI-MS: CYP2B1 + 8-MOP 35000 2722.1 30000 25000 Counts 20000 15000 10000 5000 0 2500 2600 2700 2800 2900 3000 Mass (m/z) 2721.9 ± 0.1 290-ISLLSLFFAGTETSSTTLRYGFLLM-314 (2721.2 Da) SRS-4 (I helix)
  • 15. CYP2B1 + 8-MOP 8-MOP
  • 16. CYP3A4 + L-754,394 SDS-PAGE HPLC MALDI-MS Biochemistry 39, 4276-4287 (1999)
  • 17. MALDI-MS: CYP3A4 + L-754,394 4000 4705.2 3000 Counts 2000 1000 0 4000 4300 4600 4900 5200 5500 Mass (m/z) 4704.2 ± 1.0 275-IDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIM-317 (4703.2 Da) SRS-4 (I-helix)
  • 19. raloxifene- adducted PIA adducted CYP3A4 peptide, (Cys-reacting) 237-NICVFPR-243. Cys239 No radiolabel MS2 adducted peptide from proteinase K digest MS3
  • 20. Cys239 3 peptide from tryptic digest Tyrosine 75
  • 21. 2011 2011 CYP2B6 CYP2B6 + clopidogrel CYP2B6+ clopidogrel+ DTT
  • 22. Other studies 2004 2005 2006
  • 23. Other studies 2010 2011 2012
  • 24. Conclusions • LC/MS analyses of intact CYP450s is possible – Short run times, accurate • Adducted intact proteins and peptide adducts can be identified without use of a radiolabeled molecule
  • 25. Future Directions? • Crystal structures of adducted proteins • Proteomic analysis and scanning for adducts? – Microsomes, hepatocytes – Supersomes – Labeled compounds or isotope labeled proteins – Affinity purification techniques – Potential issues with ESI • Amount of protein required  clogging of columns • Stability of adducts to workup conditions – MALDI
  • 26. Future Directions – MALDI? • Tumor specific protein signals were detected • Proteomic information was extracted • Try with HLMs
  • 27. Thank you!! Luke Lightning, PhD Alquest Therapeutics llightning@alquest.us http://www.meetup.com/BayAreaLifeTech/ Next event: Happy Hour in SF, Thursday 7/12/2012