SlideShare uma empresa Scribd logo
1 de 26
Domains, Trends, Distribution,
Types, Cost, and Mapping Tracking

Novita Nurwahyuningsih 1111113000017;
Leny Lediyawati 1111113000040;
Revi Marlina 11111113000096;
Ash Shiddiq 111211300021;
Dara Atika Suri 111211300076.
what conditions that allows the
conflict?
When members of one or more potential
antagonistic parties shared identity
Generate a sense of grievance
Form a goal to change another party so
as to reduce the grievance
Change: Revolution or Conflict?
“ I think
Revolution as
well as WARS.
Look at my
Thesis (Jews in
Sensate Culture)
in 1973”

PITIRIM ALEXANDROVICH SOROKIN
Self and Other Identity
 Identities vary in expanse, from individuals to
vast collectivities, and they may be long enduring
or ephermal.
 Ethnic as well as other identities serve as a basis
for mobilization and organization.
 Identities are socially constructed on the bases
of various traits and experiences.
 Ethnics traits are often socially regarded as set at
birth, such as parental decent, religious origin,
place of birth, and skin color.
Internal Characteristic
Many Interrelated internal characteristics
foster forming a self-identified collectivity
1.
2.
3.
4.

Homogenity
Ease of Communication
Clear Boundaries
Organizational Potensial
What is national Interest in this
context?
The Conflict Domain
- Conflict Resolution analysts have traditionally include all levels
of conflict from intrapersonal conflict through to International
Conflict, and all stages of conflict escalation and de-escalation.

- Conflict resolution focus to actual or potentially violent conflicts,
ranging from social conflict situations which treathen to become
militarized beyond the capacity of domestic civil police control,
through to full scale interstate war.
Five stages of escalation
•
•
•
•
•

Peaceful stable situation
Political tension situation
Violent political conflict
Low intensity conflict
High intensity conflict
Transformation in conflict studies
• Traditional Analyst . by Richardson
• Correlates of War (COW) Project . by singer
and small. Defined as conflicts “involving at
least one member of the interstate system on
each side of the war, resulting in a total of
1000 or more battle death”
Co’d
• AKUF project by wallensteen, initiated by kende and
developed by gantzel, “conflict as a result of the new
forms of production, monotarization of the economy
and the resulting dissolution of traditional forms of
social integration”
• UPPSALA project concept of armed conflict defined as
prolonged combat between the military forces of two
or more governments, or of one government and at
least one organized armed group, and incurring the
battle related death of at least 1000 people for the
duration of the conflict.
Co’d
• CIDCM Project, the minorities at risk project
within this brave, list are drown up of ethnonationalist peoples who have fought sustained or
recurrent campaigns of armed forced aimed at
least in part at securing national independence
for a communal group, or their unification with
kindred groups in adjoining states. Terrorist and
guerilla strategic are count.
• Humanitarianism and war project,populations at
risk in complex humanitarian emergencies.
Conflict Trends
• According to the Uppsala University data over
period 1989-1996 there was an almost constant
decline in the number of major armed conflicts
worldwide.
• There was a pattern of conflict in 1990s in which
the prime emphasis was on challanges to
existing state authority, including secessionist
movements which treaten the territorial
integrity of the state and challanges to central
control which may also end in fragmentation
with no one actor in overall command.
Distribution
Dengan berakhirnya perang dingin,
pola daerah konflik menjadi lebih
signifikan pada pola regional atau
kawasan.
terdapat
beberapa
perbedaan karakter konflik dari
wilayah satu ke wilayah lain. Terdiri
dari “zones of peace" dan “zones of
war".
Variasi Konflik
• Dari setiap regional memiliki karakteristik yang
berbeda-beda.
• “pluralistic security communities”
• Zones of peace
• No-war zones
• Zones of war
Conflict Types
• Interstate : Gulf War
• Non-interstate
a) revolution / ideology : Algeria
b) Identity / secession : Sri Lanka
c) Factional : Liberia
Singer’s conflict typology
a)
b)
c)
d)

Interstate wars
Extra-systemic (mainly colonial) wars
“civil” conflicts
The increasingly complex intrastate wars in
former colonial states
Holsti’s conflict typology
a) Standard state versus state wars : china and
india in 1962
b) Decolonizing wars of “national liberation”
c) Internal wars based on ideological goals : the
Sendero Luminoso in Peru
d) State-nation wars including armed resistance by
ethnic, language and/or religious groups, often
with the purpose of secession or separation
from the state : the Tamils in Sri Lanka
CONFLICT COST
- Manusia




(Terutama Wanita dan anak-anak)
28 juta orang terbunuh dalam 150 konflik
bersenjata di dunia ketiga sejak 1945
(IISS, 1997); 40 juta sipil dan militer
tewas (Leitenberg); PD 2 mengakibatkan
sebanyak 50 persen sipil yang tewas
meningkat sejak PD 1(Lake,ed.,1940)
Terutama di negara berkembang/dunia
ketiga, akibat kelaparan menyebabkan
orang-orang berkonflik untuk mendapatkan
makanan, sebab hal tersebut merupakan cara
agar mereka bertahan hidup (Negara-negara
Afrika: Angola, Eritrea, Liberia,
Mozambique, Rwanda, Somalia, Sudan)
Co'd
-

Pertumbuhan Ekonomi pada negara yang terlibat
konflik (in context internal conflicts)
Failing production; Failing Exports; Greater
indebtness; Failing social expenditure
- Efek terhadap negara tetangga
Karena masih dalam satu kawasan regional, jelas
akan mengurangi pertumbuhan ekonomi negara
sekitar
- Diversion to military purpose
- TOC
Drugs, senjata, humman trafficking
- Lingkungan Sekitar
Case Study

MOZAMBIQUE
Conflict Mapping and Conflict
Tracking
•Conflict Mapping?
•First Step in Intervening to Manage a Particular
Conflict. It Gives Both The Intervenor and The
Conflict Parties a Clearer Understanding of The
Origin, Nature, Dynamics and Possibilities for
Resolution of The Conflict. (Paul Wehr/1997:18)
A Conflict Mapping Guide
A. Background
B. The Conflict Parties and
Issues
C. The Context: Global,
Regional, and State-Level
Actors. (Wehr:1979)
Co'd








Next Step?
Menggunakan informasi di map untuk
mengidentifikasi cakupan resolusi konflik.
Perubahan dalam konteks yang mana dapat
merubah situasi konflik
Perubahan dalam atau antar pihak yang
berkonflik
Meredefinisi tujuan dan mencari alternatif untuk
menyelesaikan perbedaan
Co'd
Conflict Tracking?
For Keep Updating
How?
Internet
Terdapat beberapa website yang dirancang untuk conflict
tracking, diantaranya:
www.icg.org, www.euroconflict.org, www.incore.ulst.ac.uk.
Thank you
Any question? 

Mais conteúdo relacionado

Mais procurados

Mac201 hidden agendas propaganda seminar
Mac201 hidden agendas propaganda seminarMac201 hidden agendas propaganda seminar
Mac201 hidden agendas propaganda seminarRob Jewitt
 
Welcome to-our-presentation
Welcome to-our-presentationWelcome to-our-presentation
Welcome to-our-presentationMeyan Nayem
 
Media imperialism
Media imperialismMedia imperialism
Media imperialismLeslie Chan
 
Cultural imperialism
Cultural imperialismCultural imperialism
Cultural imperialismAndy Wallis
 
Nationalism overview - Unit 5B Other Ideological Traditions
Nationalism overview - Unit 5B Other Ideological TraditionsNationalism overview - Unit 5B Other Ideological Traditions
Nationalism overview - Unit 5B Other Ideological Traditionssarahbutterworth
 
Cultural imperialism and it’s effects in Pakistan.
Cultural imperialism and it’s effects in Pakistan.Cultural imperialism and it’s effects in Pakistan.
Cultural imperialism and it’s effects in Pakistan.Ch Adil
 
Cultural imperialism
Cultural imperialismCultural imperialism
Cultural imperialismSandra Waters
 
Islam within europe, clash of civilizations
Islam within europe, clash of civilizationsIslam within europe, clash of civilizations
Islam within europe, clash of civilizationsNari Hakobian
 
Globalization: A Threat to Cultural Diversity?
Globalization: A Threat to Cultural Diversity?Globalization: A Threat to Cultural Diversity?
Globalization: A Threat to Cultural Diversity?Larissa Prokopenko
 
World history knowledge map
World history knowledge mapWorld history knowledge map
World history knowledge mapJoe McClung
 
1.2 theories of nationalism
1.2 theories of nationalism1.2 theories of nationalism
1.2 theories of nationalismAlona Salva
 
Electronic colonialism- ZK
Electronic colonialism- ZKElectronic colonialism- ZK
Electronic colonialism- ZKZareen Khan
 
Cultural colonialism
Cultural colonialismCultural colonialism
Cultural colonialismHina Anjum
 
Justifications For Humanitarian Intervention
Justifications For Humanitarian InterventionJustifications For Humanitarian Intervention
Justifications For Humanitarian InterventionMarchwinskiJ
 
Types of internationalism visual
Types of internationalism visualTypes of internationalism visual
Types of internationalism visualmylespeck
 

Mais procurados (20)

Nationalism 2009
Nationalism 2009Nationalism 2009
Nationalism 2009
 
Mac201 hidden agendas propaganda seminar
Mac201 hidden agendas propaganda seminarMac201 hidden agendas propaganda seminar
Mac201 hidden agendas propaganda seminar
 
Welcome to-our-presentation
Welcome to-our-presentationWelcome to-our-presentation
Welcome to-our-presentation
 
Media imperialism
Media imperialismMedia imperialism
Media imperialism
 
Cultural imperialism
Cultural imperialismCultural imperialism
Cultural imperialism
 
Cultural imperialism
Cultural imperialismCultural imperialism
Cultural imperialism
 
Cultural Imperialism
Cultural ImperialismCultural Imperialism
Cultural Imperialism
 
Nationalism overview - Unit 5B Other Ideological Traditions
Nationalism overview - Unit 5B Other Ideological TraditionsNationalism overview - Unit 5B Other Ideological Traditions
Nationalism overview - Unit 5B Other Ideological Traditions
 
Cultural imperialism and it’s effects in Pakistan.
Cultural imperialism and it’s effects in Pakistan.Cultural imperialism and it’s effects in Pakistan.
Cultural imperialism and it’s effects in Pakistan.
 
Cultural imperialism
Cultural imperialismCultural imperialism
Cultural imperialism
 
Islam within europe, clash of civilizations
Islam within europe, clash of civilizationsIslam within europe, clash of civilizations
Islam within europe, clash of civilizations
 
Globalization: A Threat to Cultural Diversity?
Globalization: A Threat to Cultural Diversity?Globalization: A Threat to Cultural Diversity?
Globalization: A Threat to Cultural Diversity?
 
World history knowledge map
World history knowledge mapWorld history knowledge map
World history knowledge map
 
Nationalism
NationalismNationalism
Nationalism
 
1.2 theories of nationalism
1.2 theories of nationalism1.2 theories of nationalism
1.2 theories of nationalism
 
Electronic colonialism- ZK
Electronic colonialism- ZKElectronic colonialism- ZK
Electronic colonialism- ZK
 
Cultural colonialism
Cultural colonialismCultural colonialism
Cultural colonialism
 
Justifications For Humanitarian Intervention
Justifications For Humanitarian InterventionJustifications For Humanitarian Intervention
Justifications For Humanitarian Intervention
 
Types of internationalism visual
Types of internationalism visualTypes of internationalism visual
Types of internationalism visual
 
Nation and Nationalism Theories
Nation and Nationalism TheoriesNation and Nationalism Theories
Nation and Nationalism Theories
 

Destaque

Inventory of Existing Rido in Lanao del Sur
Inventory of Existing Rido in Lanao del SurInventory of Existing Rido in Lanao del Sur
Inventory of Existing Rido in Lanao del SurGaphor Panimbang
 
Conflict Resolution: Practical Tools and Techniques
Conflict Resolution: Practical Tools and TechniquesConflict Resolution: Practical Tools and Techniques
Conflict Resolution: Practical Tools and TechniquesOmar Pidani
 
Conflict management and resolution
Conflict management and resolutionConflict management and resolution
Conflict management and resolutionCharles Cotter, PhD
 
Conflict Analysis and Peace Building
Conflict Analysis and Peace BuildingConflict Analysis and Peace Building
Conflict Analysis and Peace BuildingGaphor Panimbang
 
Tools for conflict analysis
Tools for conflict analysisTools for conflict analysis
Tools for conflict analysisLo Ivan
 
Conflict management presentation
Conflict management presentationConflict management presentation
Conflict management presentationMal Cocklin
 
Presidential System Over Parliamentary System
Presidential System Over Parliamentary SystemPresidential System Over Parliamentary System
Presidential System Over Parliamentary SystemRima Doot
 
Comparative Education Project Educ.604
Comparative Education Project Educ.604Comparative Education Project Educ.604
Comparative Education Project Educ.604Pamela Noble
 
PPT conflict management
PPT conflict managementPPT conflict management
PPT conflict managementITC Limited
 
Conflict Resolution Strategies
Conflict Resolution Strategies Conflict Resolution Strategies
Conflict Resolution Strategies Maysoun Mohamed
 

Destaque (13)

Inventory of Existing Rido in Lanao del Sur
Inventory of Existing Rido in Lanao del SurInventory of Existing Rido in Lanao del Sur
Inventory of Existing Rido in Lanao del Sur
 
Conflict Resolution: Practical Tools and Techniques
Conflict Resolution: Practical Tools and TechniquesConflict Resolution: Practical Tools and Techniques
Conflict Resolution: Practical Tools and Techniques
 
Conflict management and resolution
Conflict management and resolutionConflict management and resolution
Conflict management and resolution
 
Conflict Analysis and Peace Building
Conflict Analysis and Peace BuildingConflict Analysis and Peace Building
Conflict Analysis and Peace Building
 
Tools for conflict analysis
Tools for conflict analysisTools for conflict analysis
Tools for conflict analysis
 
Conflict management presentation
Conflict management presentationConflict management presentation
Conflict management presentation
 
Muslim in europe presentation
Muslim in europe presentationMuslim in europe presentation
Muslim in europe presentation
 
Presidential System Over Parliamentary System
Presidential System Over Parliamentary SystemPresidential System Over Parliamentary System
Presidential System Over Parliamentary System
 
Comparative Education Project Educ.604
Comparative Education Project Educ.604Comparative Education Project Educ.604
Comparative Education Project Educ.604
 
Conflict resolution
Conflict resolutionConflict resolution
Conflict resolution
 
Conflict Management
Conflict ManagementConflict Management
Conflict Management
 
PPT conflict management
PPT conflict managementPPT conflict management
PPT conflict management
 
Conflict Resolution Strategies
Conflict Resolution Strategies Conflict Resolution Strategies
Conflict Resolution Strategies
 

Semelhante a Ppt reskon fix

explaining Conflict and its types.pptx
explaining Conflict and its types.pptxexplaining Conflict and its types.pptx
explaining Conflict and its types.pptxsadafraja10
 
Political Science 7 – International Relations - Power Point #7
Political Science 7 – International Relations - Power Point #7Political Science 7 – International Relations - Power Point #7
Political Science 7 – International Relations - Power Point #7John Paul Tabakian
 
Genocide & Nation state
Genocide & Nation stateGenocide & Nation state
Genocide & Nation stateShivesh Ranjan
 
Undergraduate Honors Thesis
Undergraduate Honors ThesisUndergraduate Honors Thesis
Undergraduate Honors ThesisPhilip Sweigart
 
Global Media cultures
Global Media culturesGlobal Media cultures
Global Media cultureserickajoy4
 
globalmediacultures-201205091129 (1).pptx
globalmediacultures-201205091129 (1).pptxglobalmediacultures-201205091129 (1).pptx
globalmediacultures-201205091129 (1).pptxRamirSimbre3
 
ferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfKanikaBansal52
 
Nationalism is exclusionary by definition
Nationalism is exclusionary by definitionNationalism is exclusionary by definition
Nationalism is exclusionary by definitionAzmiSuhaimi
 
CIVIC EDUCATION AND IT’S IMPERATIVE TOWARDS NATION BUILDING: THE NIGERIAN EXA...
CIVIC EDUCATION AND IT’S IMPERATIVE TOWARDS NATION BUILDING: THE NIGERIAN EXA...CIVIC EDUCATION AND IT’S IMPERATIVE TOWARDS NATION BUILDING: THE NIGERIAN EXA...
CIVIC EDUCATION AND IT’S IMPERATIVE TOWARDS NATION BUILDING: THE NIGERIAN EXA...John1Lorcan
 
Tabakian Pols 7 Fall/Spring 2014 Power 7
Tabakian Pols 7 Fall/Spring 2014 Power 7Tabakian Pols 7 Fall/Spring 2014 Power 7
Tabakian Pols 7 Fall/Spring 2014 Power 7John Paul Tabakian
 
Words As Definitions of Experience 3
Words As Definitions of Experience 3Words As Definitions of Experience 3
Words As Definitions of Experience 3Clive McGoun
 
Clash of civilizations
Clash of civilizationsClash of civilizations
Clash of civilizationsAima Buttar
 
Xinjiang article by Dr. A.R.M. Imtiyaz.doc for 11122013
Xinjiang article by Dr. A.R.M. Imtiyaz.doc for 11122013Xinjiang article by Dr. A.R.M. Imtiyaz.doc for 11122013
Xinjiang article by Dr. A.R.M. Imtiyaz.doc for 11122013A.R.M. Imtiyaz
 
What Causes Countries to Enter Civil WarIntroduction For th.docx
What Causes Countries to Enter Civil WarIntroduction For th.docxWhat Causes Countries to Enter Civil WarIntroduction For th.docx
What Causes Countries to Enter Civil WarIntroduction For th.docxalanfhall8953
 
Conflict resolution models in interfaith dialogues
Conflict resolution models in interfaith dialoguesConflict resolution models in interfaith dialogues
Conflict resolution models in interfaith dialoguesDomenic Marbaniang
 

Semelhante a Ppt reskon fix (20)

explaining Conflict and its types.pptx
explaining Conflict and its types.pptxexplaining Conflict and its types.pptx
explaining Conflict and its types.pptx
 
Essay
EssayEssay
Essay
 
Political Science 7 – International Relations - Power Point #7
Political Science 7 – International Relations - Power Point #7Political Science 7 – International Relations - Power Point #7
Political Science 7 – International Relations - Power Point #7
 
Gated Communities Essay
Gated Communities EssayGated Communities Essay
Gated Communities Essay
 
Genocide & Nation state
Genocide & Nation stateGenocide & Nation state
Genocide & Nation state
 
Perspective on Civilization Lecture 1
Perspective on Civilization Lecture 1Perspective on Civilization Lecture 1
Perspective on Civilization Lecture 1
 
Undergraduate Honors Thesis
Undergraduate Honors ThesisUndergraduate Honors Thesis
Undergraduate Honors Thesis
 
Soc 451, 4th class
Soc 451, 4th classSoc 451, 4th class
Soc 451, 4th class
 
Global Media cultures
Global Media culturesGlobal Media cultures
Global Media cultures
 
globalmediacultures-201205091129 (1).pptx
globalmediacultures-201205091129 (1).pptxglobalmediacultures-201205091129 (1).pptx
globalmediacultures-201205091129 (1).pptx
 
ferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfferneeamericancivilwar.pdf
ferneeamericancivilwar.pdf
 
Nationalism is exclusionary by definition
Nationalism is exclusionary by definitionNationalism is exclusionary by definition
Nationalism is exclusionary by definition
 
CIVIC EDUCATION AND IT’S IMPERATIVE TOWARDS NATION BUILDING: THE NIGERIAN EXA...
CIVIC EDUCATION AND IT’S IMPERATIVE TOWARDS NATION BUILDING: THE NIGERIAN EXA...CIVIC EDUCATION AND IT’S IMPERATIVE TOWARDS NATION BUILDING: THE NIGERIAN EXA...
CIVIC EDUCATION AND IT’S IMPERATIVE TOWARDS NATION BUILDING: THE NIGERIAN EXA...
 
Tabakian Pols 7 Fall/Spring 2014 Power 7
Tabakian Pols 7 Fall/Spring 2014 Power 7Tabakian Pols 7 Fall/Spring 2014 Power 7
Tabakian Pols 7 Fall/Spring 2014 Power 7
 
Words As Definitions of Experience 3
Words As Definitions of Experience 3Words As Definitions of Experience 3
Words As Definitions of Experience 3
 
Delineating the Language Features of War Speeches
 Delineating the Language Features of War Speeches Delineating the Language Features of War Speeches
Delineating the Language Features of War Speeches
 
Clash of civilizations
Clash of civilizationsClash of civilizations
Clash of civilizations
 
Xinjiang article by Dr. A.R.M. Imtiyaz.doc for 11122013
Xinjiang article by Dr. A.R.M. Imtiyaz.doc for 11122013Xinjiang article by Dr. A.R.M. Imtiyaz.doc for 11122013
Xinjiang article by Dr. A.R.M. Imtiyaz.doc for 11122013
 
What Causes Countries to Enter Civil WarIntroduction For th.docx
What Causes Countries to Enter Civil WarIntroduction For th.docxWhat Causes Countries to Enter Civil WarIntroduction For th.docx
What Causes Countries to Enter Civil WarIntroduction For th.docx
 
Conflict resolution models in interfaith dialogues
Conflict resolution models in interfaith dialoguesConflict resolution models in interfaith dialogues
Conflict resolution models in interfaith dialogues
 

Último

Advantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your BusinessAdvantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your BusinessPixlogix Infotech
 
From Event to Action: Accelerate Your Decision Making with Real-Time Automation
From Event to Action: Accelerate Your Decision Making with Real-Time AutomationFrom Event to Action: Accelerate Your Decision Making with Real-Time Automation
From Event to Action: Accelerate Your Decision Making with Real-Time AutomationSafe Software
 
CNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of ServiceCNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of Servicegiselly40
 
TrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
TrustArc Webinar - Stay Ahead of US State Data Privacy Law DevelopmentsTrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
TrustArc Webinar - Stay Ahead of US State Data Privacy Law DevelopmentsTrustArc
 
Histor y of HAM Radio presentation slide
Histor y of HAM Radio presentation slideHistor y of HAM Radio presentation slide
Histor y of HAM Radio presentation slidevu2urc
 
Boost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfBoost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfsudhanshuwaghmare1
 
08448380779 Call Girls In Diplomatic Enclave Women Seeking Men
08448380779 Call Girls In Diplomatic Enclave Women Seeking Men08448380779 Call Girls In Diplomatic Enclave Women Seeking Men
08448380779 Call Girls In Diplomatic Enclave Women Seeking MenDelhi Call girls
 
IAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI SolutionsIAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI SolutionsEnterprise Knowledge
 
Slack Application Development 101 Slides
Slack Application Development 101 SlidesSlack Application Development 101 Slides
Slack Application Development 101 Slidespraypatel2
 
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptx
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptxEIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptx
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptxEarley Information Science
 
What Are The Drone Anti-jamming Systems Technology?
What Are The Drone Anti-jamming Systems Technology?What Are The Drone Anti-jamming Systems Technology?
What Are The Drone Anti-jamming Systems Technology?Antenna Manufacturer Coco
 
Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024The Digital Insurer
 
🐬 The future of MySQL is Postgres 🐘
🐬  The future of MySQL is Postgres   🐘🐬  The future of MySQL is Postgres   🐘
🐬 The future of MySQL is Postgres 🐘RTylerCroy
 
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptxHampshireHUG
 
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...Neo4j
 
Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024The Digital Insurer
 
Artificial Intelligence: Facts and Myths
Artificial Intelligence: Facts and MythsArtificial Intelligence: Facts and Myths
Artificial Intelligence: Facts and MythsJoaquim Jorge
 
Exploring the Future Potential of AI-Enabled Smartphone Processors
Exploring the Future Potential of AI-Enabled Smartphone ProcessorsExploring the Future Potential of AI-Enabled Smartphone Processors
Exploring the Future Potential of AI-Enabled Smartphone Processorsdebabhi2
 
08448380779 Call Girls In Greater Kailash - I Women Seeking Men
08448380779 Call Girls In Greater Kailash - I Women Seeking Men08448380779 Call Girls In Greater Kailash - I Women Seeking Men
08448380779 Call Girls In Greater Kailash - I Women Seeking MenDelhi Call girls
 
Raspberry Pi 5: Challenges and Solutions in Bringing up an OpenGL/Vulkan Driv...
Raspberry Pi 5: Challenges and Solutions in Bringing up an OpenGL/Vulkan Driv...Raspberry Pi 5: Challenges and Solutions in Bringing up an OpenGL/Vulkan Driv...
Raspberry Pi 5: Challenges and Solutions in Bringing up an OpenGL/Vulkan Driv...Igalia
 

Último (20)

Advantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your BusinessAdvantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your Business
 
From Event to Action: Accelerate Your Decision Making with Real-Time Automation
From Event to Action: Accelerate Your Decision Making with Real-Time AutomationFrom Event to Action: Accelerate Your Decision Making with Real-Time Automation
From Event to Action: Accelerate Your Decision Making with Real-Time Automation
 
CNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of ServiceCNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of Service
 
TrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
TrustArc Webinar - Stay Ahead of US State Data Privacy Law DevelopmentsTrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
TrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
 
Histor y of HAM Radio presentation slide
Histor y of HAM Radio presentation slideHistor y of HAM Radio presentation slide
Histor y of HAM Radio presentation slide
 
Boost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfBoost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdf
 
08448380779 Call Girls In Diplomatic Enclave Women Seeking Men
08448380779 Call Girls In Diplomatic Enclave Women Seeking Men08448380779 Call Girls In Diplomatic Enclave Women Seeking Men
08448380779 Call Girls In Diplomatic Enclave Women Seeking Men
 
IAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI SolutionsIAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI Solutions
 
Slack Application Development 101 Slides
Slack Application Development 101 SlidesSlack Application Development 101 Slides
Slack Application Development 101 Slides
 
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptx
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptxEIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptx
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptx
 
What Are The Drone Anti-jamming Systems Technology?
What Are The Drone Anti-jamming Systems Technology?What Are The Drone Anti-jamming Systems Technology?
What Are The Drone Anti-jamming Systems Technology?
 
Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024
 
🐬 The future of MySQL is Postgres 🐘
🐬  The future of MySQL is Postgres   🐘🐬  The future of MySQL is Postgres   🐘
🐬 The future of MySQL is Postgres 🐘
 
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
04-2024-HHUG-Sales-and-Marketing-Alignment.pptx
 
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
 
Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024
 
Artificial Intelligence: Facts and Myths
Artificial Intelligence: Facts and MythsArtificial Intelligence: Facts and Myths
Artificial Intelligence: Facts and Myths
 
Exploring the Future Potential of AI-Enabled Smartphone Processors
Exploring the Future Potential of AI-Enabled Smartphone ProcessorsExploring the Future Potential of AI-Enabled Smartphone Processors
Exploring the Future Potential of AI-Enabled Smartphone Processors
 
08448380779 Call Girls In Greater Kailash - I Women Seeking Men
08448380779 Call Girls In Greater Kailash - I Women Seeking Men08448380779 Call Girls In Greater Kailash - I Women Seeking Men
08448380779 Call Girls In Greater Kailash - I Women Seeking Men
 
Raspberry Pi 5: Challenges and Solutions in Bringing up an OpenGL/Vulkan Driv...
Raspberry Pi 5: Challenges and Solutions in Bringing up an OpenGL/Vulkan Driv...Raspberry Pi 5: Challenges and Solutions in Bringing up an OpenGL/Vulkan Driv...
Raspberry Pi 5: Challenges and Solutions in Bringing up an OpenGL/Vulkan Driv...
 

Ppt reskon fix

  • 1. Domains, Trends, Distribution, Types, Cost, and Mapping Tracking Novita Nurwahyuningsih 1111113000017; Leny Lediyawati 1111113000040; Revi Marlina 11111113000096; Ash Shiddiq 111211300021; Dara Atika Suri 111211300076.
  • 2. what conditions that allows the conflict?
  • 3. When members of one or more potential antagonistic parties shared identity Generate a sense of grievance Form a goal to change another party so as to reduce the grievance Change: Revolution or Conflict?
  • 4. “ I think Revolution as well as WARS. Look at my Thesis (Jews in Sensate Culture) in 1973” PITIRIM ALEXANDROVICH SOROKIN
  • 5. Self and Other Identity  Identities vary in expanse, from individuals to vast collectivities, and they may be long enduring or ephermal.  Ethnic as well as other identities serve as a basis for mobilization and organization.  Identities are socially constructed on the bases of various traits and experiences.  Ethnics traits are often socially regarded as set at birth, such as parental decent, religious origin, place of birth, and skin color.
  • 6. Internal Characteristic Many Interrelated internal characteristics foster forming a self-identified collectivity 1. 2. 3. 4. Homogenity Ease of Communication Clear Boundaries Organizational Potensial
  • 7. What is national Interest in this context?
  • 8. The Conflict Domain - Conflict Resolution analysts have traditionally include all levels of conflict from intrapersonal conflict through to International Conflict, and all stages of conflict escalation and de-escalation. - Conflict resolution focus to actual or potentially violent conflicts, ranging from social conflict situations which treathen to become militarized beyond the capacity of domestic civil police control, through to full scale interstate war.
  • 9. Five stages of escalation • • • • • Peaceful stable situation Political tension situation Violent political conflict Low intensity conflict High intensity conflict
  • 10. Transformation in conflict studies • Traditional Analyst . by Richardson • Correlates of War (COW) Project . by singer and small. Defined as conflicts “involving at least one member of the interstate system on each side of the war, resulting in a total of 1000 or more battle death”
  • 11. Co’d • AKUF project by wallensteen, initiated by kende and developed by gantzel, “conflict as a result of the new forms of production, monotarization of the economy and the resulting dissolution of traditional forms of social integration” • UPPSALA project concept of armed conflict defined as prolonged combat between the military forces of two or more governments, or of one government and at least one organized armed group, and incurring the battle related death of at least 1000 people for the duration of the conflict.
  • 12. Co’d • CIDCM Project, the minorities at risk project within this brave, list are drown up of ethnonationalist peoples who have fought sustained or recurrent campaigns of armed forced aimed at least in part at securing national independence for a communal group, or their unification with kindred groups in adjoining states. Terrorist and guerilla strategic are count. • Humanitarianism and war project,populations at risk in complex humanitarian emergencies.
  • 13. Conflict Trends • According to the Uppsala University data over period 1989-1996 there was an almost constant decline in the number of major armed conflicts worldwide. • There was a pattern of conflict in 1990s in which the prime emphasis was on challanges to existing state authority, including secessionist movements which treaten the territorial integrity of the state and challanges to central control which may also end in fragmentation with no one actor in overall command.
  • 14. Distribution Dengan berakhirnya perang dingin, pola daerah konflik menjadi lebih signifikan pada pola regional atau kawasan. terdapat beberapa perbedaan karakter konflik dari wilayah satu ke wilayah lain. Terdiri dari “zones of peace" dan “zones of war".
  • 15. Variasi Konflik • Dari setiap regional memiliki karakteristik yang berbeda-beda. • “pluralistic security communities” • Zones of peace • No-war zones • Zones of war
  • 16. Conflict Types • Interstate : Gulf War • Non-interstate a) revolution / ideology : Algeria b) Identity / secession : Sri Lanka c) Factional : Liberia
  • 17. Singer’s conflict typology a) b) c) d) Interstate wars Extra-systemic (mainly colonial) wars “civil” conflicts The increasingly complex intrastate wars in former colonial states
  • 18. Holsti’s conflict typology a) Standard state versus state wars : china and india in 1962 b) Decolonizing wars of “national liberation” c) Internal wars based on ideological goals : the Sendero Luminoso in Peru d) State-nation wars including armed resistance by ethnic, language and/or religious groups, often with the purpose of secession or separation from the state : the Tamils in Sri Lanka
  • 19. CONFLICT COST - Manusia   (Terutama Wanita dan anak-anak) 28 juta orang terbunuh dalam 150 konflik bersenjata di dunia ketiga sejak 1945 (IISS, 1997); 40 juta sipil dan militer tewas (Leitenberg); PD 2 mengakibatkan sebanyak 50 persen sipil yang tewas meningkat sejak PD 1(Lake,ed.,1940) Terutama di negara berkembang/dunia ketiga, akibat kelaparan menyebabkan orang-orang berkonflik untuk mendapatkan makanan, sebab hal tersebut merupakan cara agar mereka bertahan hidup (Negara-negara Afrika: Angola, Eritrea, Liberia, Mozambique, Rwanda, Somalia, Sudan)
  • 20. Co'd - Pertumbuhan Ekonomi pada negara yang terlibat konflik (in context internal conflicts) Failing production; Failing Exports; Greater indebtness; Failing social expenditure - Efek terhadap negara tetangga Karena masih dalam satu kawasan regional, jelas akan mengurangi pertumbuhan ekonomi negara sekitar - Diversion to military purpose - TOC Drugs, senjata, humman trafficking - Lingkungan Sekitar
  • 22. Conflict Mapping and Conflict Tracking •Conflict Mapping? •First Step in Intervening to Manage a Particular Conflict. It Gives Both The Intervenor and The Conflict Parties a Clearer Understanding of The Origin, Nature, Dynamics and Possibilities for Resolution of The Conflict. (Paul Wehr/1997:18)
  • 23. A Conflict Mapping Guide A. Background B. The Conflict Parties and Issues C. The Context: Global, Regional, and State-Level Actors. (Wehr:1979)
  • 24. Co'd     Next Step? Menggunakan informasi di map untuk mengidentifikasi cakupan resolusi konflik. Perubahan dalam konteks yang mana dapat merubah situasi konflik Perubahan dalam atau antar pihak yang berkonflik Meredefinisi tujuan dan mencari alternatif untuk menyelesaikan perbedaan
  • 25. Co'd Conflict Tracking? For Keep Updating How? Internet Terdapat beberapa website yang dirancang untuk conflict tracking, diantaranya: www.icg.org, www.euroconflict.org, www.incore.ulst.ac.uk.