SlideShare uma empresa Scribd logo
1 de 87
Baixar para ler offline
Nouvelles perspectives en
vaccinologie
AAEIP, Université Paris Sud, 31 Mars 2014
Claude Leclerc
DEVELOPPEMENT of HUMAN VACCINES 	

Live attenuated	

vaccines	

Genetically 	

engieneered	

Purified protein	

or polysaccharide	

Killed vaccines	

Smallpox, 1798	

	

	

Rabies, 1885	

	

	

	

BCG, 1927	

	

Yellow fever, 1935	

	

	

Polio (oral)	

Measles	

Mumps	

Rubella	

Adenovirus	

Typhoid (Ty21a)	

Varicella	

Rotavirus	

	

	

	

	

	

	

	

Diphteria, 1923	

Tetanus, 1927	

	

	

	

Pneumococcus	

Meningococcus	

Haemophilus influenzae PRP	

Hepatitis B (plasma derived)	

Tick-birne encephalitis	

H. influenzae PRP conjugate	

Typhoid (Vi)	

Acellular pertussis	

	

 	

	

	

	

 	

	

Typhoid 1896	

Cholera, 1896	

Plague, 1897	

	

 	

	

Pertussis, 1926 (killed bacteria)	

Influenza, 1936	

Rickettsia, 1938	

	

	

	

	

Polio (injected)	

Rabies (new)	

Japanese Encephalitis	

Hepatitis A	

	

	

	

	

	

	

	

	

	

	

	

	

	

Hepatitis B (recombinant)	

Human Papilloma virus	

Rotavirus	

	

18th Century	

19th Century	

Early 20th Century	

After World War II (cellular culture)
Vaccines have been made
for 36 of >400 human
pathogens	

Immunological Bioinformatics, The MIT press.	

+HPV & Rotavirus
The different types of vaccines
Attenuated
Vaccines
Killed
Vaccines
Acellular sub-
unit vaccines
Pertussis	

Diphteria	

Hepatitis B	

Tetanus	

Cholera	

Pertussis	

Hepatitis A	

Polio	

Polio	

Yellow fever	

BCG
New and improved technologies and resulting
vaccines
R Rappuoli, CW. Mandl, S Black & E De Gregorio
Nature Reviews Immunology Published online 4 November 2011
New and improved technologies and resulting
vaccines
R Rappuoli, CW. Mandl, S Black & E De Gregorio
Nature Reviews Immunology Published online 4 November 2011
New and improved technologies and resulting
vaccines
R Rappuoli, CW. Mandl, S Black & E De Gregorio
Nature Reviews Immunology Published online 4 November 2011
New and improved technologies and resulting
vaccines
R Rappuoli, CW. Mandl, S Black & E De Gregorio
Nature Reviews Immunology Published online 4 November 2011
New and improved technologies and resulting
vaccines
R Rappuoli, CW. Mandl, S Black & E De Gregorio
Nature Reviews Immunology Published online 4 November 2011
R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature
Reviews Immunology Published online 4 November
2011
R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature
Reviews Immunology Published online 4 November
2011
Dengue epidemiology
Nature Reviews Microbiology 2010
Dengue vaccines under development
Dengue vaccines under development
Sanofi Pasteur dengue vaccine enters phase III
clinical study in October 2010
The yellow fever 17D virus as a platform for new
live attenuated vaccines
Worldwide map of phase II/III dengue clinical trials, and major results
obtained so far in humans
Guy et al, Vaccine, 2011, 7229-7241
Lancet, Published Online, September 11, 2012
Serotype-specific and overall efficacy of CYD tetravalent dengue vaccine against
virologically confirmed dengue disease
Reverse cumulative distribution of serotype-specific PRNT 50 antibody titres curves for DENV
serotypes 1–4 by baseline FV-serostatus, pre-vaccination and after two and three doses of CYD-TDV
(Full Analysis Set).
Vaccine, Volume 31, 2013, 5814 - 5821
sReuters, March 25, 2014
R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature
Reviews Immunology Published online 4 November
2011
Schematic representation of the CSP and the RTS,S
vaccine
P D. Crompton, SK. Pierce, L H. Miller J Clin Invest. 2010
Malaria cuts risk in half in late-stage trial
H Waters Nature Medicine Nov 2011
N Eng J Med 2012
Malaria cuts risk in half in late-stage trial
H Waters Nature Medicine Nov 2011
31%
R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature
Reviews Immunology Published online 4 November
2011
How to discover protective
antigens?
Identification of new target antigens: impact of genomics	

Whole genome sequences of most bacterial pathogens and 	

parasites completed	

E. coli K-12 	

B. burgdorferi 	

B. subtilis 	

M. tuberculosis 	

R. prowazekii	

H. influenzae 	

C. pneumoniae 	

C. trachomatis 	

N. gonorrhoeae 	

S. aureus	

H. pylori 	

P. horikoshü 	

E. faecalis 	

N. meningitidis 	

S. epidermitis	

M. genitalium 	

S. pneumoniae 	

L. pneumophila 	

P. falciparum 	

S. pyogenes	

M. pneumoniae 	

T. pallidum 	

L. major 	

P. aeruginosa 	

T. cruzi	

	

 	

M. leprae 	

P. aerophilum 	

V. cholerae
Genomic-based vaccine development	

Whole genomic sequence	

Computer prediction	

Expression of recombinant proteins	

DNA preparation	

In silico vaccine candidates	

Immunogenicity testing in animal models	

Vaccine development
600 potential vaccine candidates
identified
350 proteins successfully expressed
in E.coli
344 proteins purified and used
to immunize mice
355 sera tested
91 novel surface-exposed
proteins identified
28 novel proteins
have bactericidal
activity
Meningoccocal B Vaccine: A Genomic Approach
5 vaccine candidates Rappuoli et al, 2002	

Clinical trials
2000	

 2013
R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature
Reviews Immunology Published online 4 November
2011
Front Immunol 2014	

Structural vaccinology
A new computational method to design epitope-focused
vaccines, illustrated with a neutralization epitope from RSV
	
  Nature 507, 201–206 (13 March 2014)
Nature 507, 201–206 (13 March 2014)
Induction of neutralizating antibodies against RSV
R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature
Reviews Immunology Published online 4 November
2011
Overview of the problems and methodologies of systems vaccinology	

Seminars in Immunology, 2013, 209 - 218
R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature
Reviews Immunology Published online 4 November
2011
Alum adjuvants are non-cystalline gels based on aluminum oxyhydroxide (referred
to as Aluminum hydroxide gel), aluminum hydroxyphosphate (referred to as
aluminum phosphate gel) or various proprietary salts such as aluminum hydroxy-
sulfate)
Alum is used in several licensed vaccines including:
•  diphtheria-pertusis-tetanus
•  diphtheria-tetanus (DT)
•  DT combined with Hepatitis B (HBV)
•  Haemophilus influenza B
•  inactivated polio virus
•  Hepatitis A (HAV)
•  Streptoccucus pneumonia
•  Menngococccal
•  Human papilloma virus (HPV)
Vaccines containing Alum Adjuvant
Dendritic cells initiate antigen-specific immune
responses	

•  most efficient of all APCs	

•  high MHC class I, II & costimulators	

•  efficient cross presentation	

•  stimulate naïve T cells (CD4, CD8) 	

All immunization strategies must target DCs	

Initiate Ag-specific immune responses
Multiple inducers of DC maturation	

Immature DC	

 Mature DC	

various T cell
responses	

Microbial products / TLR ligands	

Viral products	

Inflammatory cytokines	

Signaling receptors
Antigen-presenting cells serve as the bridge between
innate and antigen-specific responses	

2003, 2, 727-735
Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Nov 2011
Vaccine adjuvants
Innate immune responses
Innate Lymphoid Cells (ILC)
T cell differentiation pathways
Coomes S M et al. Open Biol. 2013;3:120157
©2013 by The Royal Society
Therapeutic vaccines	

for chronic infections or cancers
Cancer, a worldwide burden
 1st cause of mortality in France
 In Europ, in 2012:
- 1.75 million deaths from cancer
-  3.45 million new cases of cancer
 In the world, in 2012:
- 8.2 millions deaths
- 14 million new cases diagnosed
Cancer, a cell disease
uncontrolled proliferation
Tumor
Surgery
ChimiotherapyRadiotherapy
Anti-angiogenic
drugs
Immune responses can control the growth of tumor
cells
The immunosurveillance theory
“It is by no means inconceivable that small
accumulations of tumour cells may develop
and because of their possession of new
antigenic potentialities provoke an effective
immunological reaction, with regression of
the tumor and no clinical hint of its existence”
British Med Journal, April 1957Burnet
Tumor specific/associated antigens
Overexpressed self
antigens
Differentiation antigens
Mutated self antigens
Non self
oncoviral antigens
Altered self antigens:
Abnormal post-
translational/
transcriptional
modification:
underglycosylation
The concept of therapeutic anti-cancer vaccines
	

  Induction of specific immune responses
against tumor specific/associated antigens to
kill tumor cells or prevent their growth
without affecting normal cells
Tumor vaccines
- Whole tumor cells: + BCG or DETOX, e.g. Melacine vaccine (cell lysates), CancerVax
( irradiated melanoma cell lines), M-Vax (hapten-treated autologous cells) and gene-
modified, irradiated tumor cells (GM-CSF)	

	

- Tumor antigens: MAGE-1, MAGE-3, MART-1/Melan-A, tyrosinase, gp100, MUC-1,
CEA, etc. 	

	

- Peptide vaccines: mutated ras, mutated p53, Her-2/neu, MART -1, gp100, MUC-1	

	

- Heat shock proteins	

	

- DNA vaccines 	

	

- Dendritic cell vaccines
Response rate = 3. 8%
Current human cancer vaccines show very low objective clinical response rate
Rosenberg, Yang & Restifo
Nature Med 10:909 (2004)
Response rate = 3. 8%
Current human cancer vaccines show very low objective clinical response rate	

Rosenberg, Yang & Restifo
Nature Med (2004)
Benefit of passive immunotherapy
(antibodies)
in cancer patients
Lack of efficacy of most
current therapeutic cancer vaccines
Problems
Tumor derived antigens are weakly
immunogenic
Need for better adjuvants 	

or immunisation strategies
Dendritic cells initiate antigen-specific
immune responses
•  most efficient of all antigen-presenting cells	

•  stimulate naïve T cells (CD4, CD8)	

	

All immunization strategies must target DCs
An Approach to Initiating Immunity to Cancer:
Dendritic Cells Loaded with Tumor Antigens ex vivo
DC precursors
expanded
immature DCs
add
disease-
related
antigens
maturing DCs
presenting antigen(s)
Tumor-
specific
T cells
responding
to
dendritic
cells
2010: FDA panel passes first cancer vaccine
Original Article
Sipuleucel-T Immunotherapy for Castration-
Resistant Prostate Cancer
Philip W. Kantoff, M.D., Celestia S. Higano, M.D., Neal D. Shore, M.D., E. Roy
Berger, M.D., Eric J. Small, M.D., David F. Penson, M.D., Charles H. Redfern, M.D.,
Anna C. Ferrari, M.D., Robert Dreicer, M.D., Robert B. Sims, M.D., Yi Xu, Ph.D., Mark
W. Frohlich, M.D., Paul F. Schellhammer, M.D., for the IMPACT Study Investigators
N Engl J Med
Volume 363(5):411-422
July 29, 2010
Source: www.provenge.com/
Provenge clinical trials : prostate cancer
Source: www.provenge.com/
Provenge clinical trials : prostate cancer
Cancer vaccine pipeline
Problems
Tumor derived antigens are weakly
immunogenic
Need for better adjuvants 	

or immunisation strategies
CD8+
T cell
CD4+
T cell
Dendritic cell	

Induction of optimized T cell responses	

by in vivo dendritic cells targeting
Antigen	

targeting	

Maturation signals	

2	

1	

 Adjuvant
CyaA: a new proteinic vector targeted to dendritic cells
Bordetella pertussis
Dermonecrotic Toxin
BrkA
FHA
TCF
FIM
TCT
Pertussis Toxin
cAMP
Pertactin
Adenylate cyclase
Toxin
Dendritic
Cell
CD11b/CD18
AC
domain
RTX
domain
1 400 1706
Internalization
Endosomes
Cytosol
CyaA binds to CD11b
allowing efficient targeting
to dendritic cells
Guermonprez et al, J. Exp. Med, 2001
Adenylate cyclase (CyaA)
Recombinant CyaA	

+	

Activation of CD8+	

Cytotoxic T lymphocytes	

Dendritic Cell	

ϕ	

CD11b/CD18	

Antigen	

Th	

CD4+	

MHC-II	

endosomes	

lysosomes	

ϕ	

ϕ
MHC class II presentation	

Activation of CD4+	

Helper T lymphocytes	

MHC class I presentation 	

Endoplasmic	

Reticulum	

CTL	

CD8+	

MHC-I/β2	

ϕ	

Translocation	

 Endocytosis	

Antigens grafted in CyaA are delivered to both MHC class I & MHC
class II presentation pathways
Immunisation in mice and non-human primates by
recombinant CyaA carrying a variety of antigens (such as
from M. tuberculosis or HIV) stimulates strong CTL and Th1
responses, even in the absence of adjuvant.
Préville et al, Cancer Res, 2005, Mascarell et al, J. Virol 2005, Majlessi et al, Inf Immun,
2005, Hervas-Stubb et al, Inf Immun, 2006, Mascarell et al, Vaccine 2006, Berraondo et al,
Cancer Res, 2007, Fayolle et al, Vaccine 2010.	

CyaA: a new proteinic vector targeted to
dendritic cells
80
HPV infection life cycle
Few months to few years Up to 20 years
Goodman A., Wilbur D. C.
Human papilloma virus
- The HPV E6 and E7 oncoproteins are expressed 	

 	

	

throughout the replicative cycle of the virus and are 	

 	

	

necessary for the onset and maintenance of malignant 	

	

transformation.
	

- HPV E6 and E7 antigens are potential targets for specific
	

immunotherapy. 	

Rational
MHGDTPTLHEYMLDLQPETTDLYCYEQLN
CyaAE5
GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
CyaA-E7∆30-42
Catalytic domain
224 235
319 320
1 400 1706
LQ
LQ
Recombinant CyaA carrying E7 from HPV16
GMP batch produced in recombinant E. coli
Therapeutic vaccination with recombinant
HPV16-E7 CyaAs eradicates established tumors
No treatment	

 CyaA-OVA	

0	

500	

1000	

1500	

2000	

0	

10	

5/5 	

 10/10 	

0/10 	

20	

30	

40	

50	

60	

70	

80	

90	

0	

500	

1000	

1500	

2000	

CyaA-HPV16E7∆30-42	

- Graft of TC-1 cells at day 0	

- At day 10, one injection of:	

- 50 µg of CyaA-E7 or 	

of control CyaA-OVA	

Preville et al, Cancer Res. 2005; Berraondo, K. et al. Cancer Res. 2007
A therapeutic vaccine candidate against HPV chronic infection
and/or cervical cancer
Clinical trials started in 2010
0 102030405060708090
0
500
1000
1500
2000
0 102030405060708090
0
500
1000
1500
2000
0 102030405060708090100
0
20
40
60
80
100
0 5 10 15 20 25 30 35
0.0
0.2
10
20
daysdays days
CyaAE5 HPV16E7∆30-42CyaAE5 CysOVA
Controls
One injection at
Day 10
CyaAE5 HPV16E7∆30-42
Préville et al, Cancer Res, 2005
http://www.genticel.com	

ProCervix - Phase 2 Clinical Trial
Merci de votre attention !
claude.leclerc@pasteur.fr

Mais conteúdo relacionado

Mais procurados

Mais procurados (20)

Oral vaccines opportunities and challenges
Oral vaccines   opportunities and challengesOral vaccines   opportunities and challenges
Oral vaccines opportunities and challenges
 
Introduction to Immunology
Introduction to ImmunologyIntroduction to Immunology
Introduction to Immunology
 
Vaccines
VaccinesVaccines
Vaccines
 
Vaccine
VaccineVaccine
Vaccine
 
Vaccines & immunomodulation
Vaccines & immunomodulationVaccines & immunomodulation
Vaccines & immunomodulation
 
History of immunology
History of immunologyHistory of immunology
History of immunology
 
LIVE BACTERIA VACCINES actual
LIVE BACTERIA VACCINES actualLIVE BACTERIA VACCINES actual
LIVE BACTERIA VACCINES actual
 
Vaccines –production and application
Vaccines –production and applicationVaccines –production and application
Vaccines –production and application
 
Vaccination
VaccinationVaccination
Vaccination
 
Immunology of parasitic diseases
Immunology of parasitic diseasesImmunology of parasitic diseases
Immunology of parasitic diseases
 
Parasite immunology
Parasite immunologyParasite immunology
Parasite immunology
 
History and overview of immunology
History and overview of immunologyHistory and overview of immunology
History and overview of immunology
 
Vaccinomics
VaccinomicsVaccinomics
Vaccinomics
 
East Coast fever—Outlook for a new vaccine
East Coast fever—Outlook for a new vaccine East Coast fever—Outlook for a new vaccine
East Coast fever—Outlook for a new vaccine
 
Newer vaccine
Newer vaccineNewer vaccine
Newer vaccine
 
History of immunology
History of immunologyHistory of immunology
History of immunology
 
History of Immunology | Dr.BGR Publications
History of Immunology | Dr.BGR PublicationsHistory of Immunology | Dr.BGR Publications
History of Immunology | Dr.BGR Publications
 
Immunity & infection
Immunity & infectionImmunity & infection
Immunity & infection
 
USP CHOP Annie De Groot Presentation June 2013
USP CHOP Annie De Groot Presentation June 2013USP CHOP Annie De Groot Presentation June 2013
USP CHOP Annie De Groot Presentation June 2013
 
Vaccines
VaccinesVaccines
Vaccines
 

Destaque

Vaccinarea animalelor de companie principii si scheme de Vaccinare
Vaccinarea animalelor de companie principii si scheme de VaccinareVaccinarea animalelor de companie principii si scheme de Vaccinare
Vaccinarea animalelor de companie principii si scheme de VaccinareAvocat Delia Maria Cobzariu
 
Coronaviroza-Peritonita infectioasa felina Curs an5
Coronaviroza-Peritonita infectioasa felina Curs an5 Coronaviroza-Peritonita infectioasa felina Curs an5
Coronaviroza-Peritonita infectioasa felina Curs an5 Avocat Delia Maria Cobzariu
 
Dirofilaria repens immitis patogeneza si clinic 2
Dirofilaria repens immitis patogeneza si clinic 2Dirofilaria repens immitis patogeneza si clinic 2
Dirofilaria repens immitis patogeneza si clinic 2Avocat Delia Maria Cobzariu
 
Diagnosticul Dirofilariozei Canine, Dirofilaria Immitis, Preventie si Terapie.
Diagnosticul Dirofilariozei Canine, Dirofilaria Immitis, Preventie si Terapie.Diagnosticul Dirofilariozei Canine, Dirofilaria Immitis, Preventie si Terapie.
Diagnosticul Dirofilariozei Canine, Dirofilaria Immitis, Preventie si Terapie.Care For Your Family SRL
 
Diagnosticul dermatofitozelor la carnivorele de companie dermakit prezentare
Diagnosticul dermatofitozelor la carnivorele de companie dermakit prezentareDiagnosticul dermatofitozelor la carnivorele de companie dermakit prezentare
Diagnosticul dermatofitozelor la carnivorele de companie dermakit prezentareAvocat Delia Maria Cobzariu
 

Destaque (7)

Vaccinarea animalelor de companie principii si scheme de Vaccinare
Vaccinarea animalelor de companie principii si scheme de VaccinareVaccinarea animalelor de companie principii si scheme de Vaccinare
Vaccinarea animalelor de companie principii si scheme de Vaccinare
 
Oferta cyf medical luna mai 2014 safe
Oferta cyf medical luna mai 2014 safeOferta cyf medical luna mai 2014 safe
Oferta cyf medical luna mai 2014 safe
 
Dirofilaria Preventie si Tratament 4
Dirofilaria Preventie si Tratament 4Dirofilaria Preventie si Tratament 4
Dirofilaria Preventie si Tratament 4
 
Coronaviroza-Peritonita infectioasa felina Curs an5
Coronaviroza-Peritonita infectioasa felina Curs an5 Coronaviroza-Peritonita infectioasa felina Curs an5
Coronaviroza-Peritonita infectioasa felina Curs an5
 
Dirofilaria repens immitis patogeneza si clinic 2
Dirofilaria repens immitis patogeneza si clinic 2Dirofilaria repens immitis patogeneza si clinic 2
Dirofilaria repens immitis patogeneza si clinic 2
 
Diagnosticul Dirofilariozei Canine, Dirofilaria Immitis, Preventie si Terapie.
Diagnosticul Dirofilariozei Canine, Dirofilaria Immitis, Preventie si Terapie.Diagnosticul Dirofilariozei Canine, Dirofilaria Immitis, Preventie si Terapie.
Diagnosticul Dirofilariozei Canine, Dirofilaria Immitis, Preventie si Terapie.
 
Diagnosticul dermatofitozelor la carnivorele de companie dermakit prezentare
Diagnosticul dermatofitozelor la carnivorele de companie dermakit prezentareDiagnosticul dermatofitozelor la carnivorele de companie dermakit prezentare
Diagnosticul dermatofitozelor la carnivorele de companie dermakit prezentare
 

Semelhante a Noi principii in vaccinare C Leclerc 2014

Types of Vaccinesproduced by cell culture methods.pptx
Types of Vaccinesproduced by cell culture methods.pptxTypes of Vaccinesproduced by cell culture methods.pptx
Types of Vaccinesproduced by cell culture methods.pptxAnjana Goel
 
Presentation on conventional vaccine (Quality Control and Production aspects)
Presentation on conventional vaccine (Quality Control and Production aspects)Presentation on conventional vaccine (Quality Control and Production aspects)
Presentation on conventional vaccine (Quality Control and Production aspects)Sunny Rathee
 
Nisha revrse vaccinology
Nisha revrse vaccinology Nisha revrse vaccinology
Nisha revrse vaccinology Dr Nisha Singh
 
Vaccine against viruses
Vaccine against virusesVaccine against viruses
Vaccine against virusesSadaqur Rahman
 
Reecha Vaccine PPT !! (1).ppt
Reecha Vaccine PPT !! (1).pptReecha Vaccine PPT !! (1).ppt
Reecha Vaccine PPT !! (1).pptReechaSharma8
 
Parasite Vaccines in Trials and in Use
Parasite Vaccines in Trials and in UseParasite Vaccines in Trials and in Use
Parasite Vaccines in Trials and in Usedranjansarma
 
Mci5004 biomarkers infectious diseases
Mci5004 biomarkers infectious diseasesMci5004 biomarkers infectious diseases
Mci5004 biomarkers infectious diseasesR Lin
 
IMMUNIZATION LECTURE.ppt
IMMUNIZATION LECTURE.pptIMMUNIZATION LECTURE.ppt
IMMUNIZATION LECTURE.pptSamboZailani1
 
Immunization with sars coronavirus vaccines leads to pulmonary immunopathology
Immunization with sars coronavirus vaccines leads to pulmonary immunopathologyImmunization with sars coronavirus vaccines leads to pulmonary immunopathology
Immunization with sars coronavirus vaccines leads to pulmonary immunopathologyLANStillH2O
 
recombinant drugs.pdf
recombinant drugs.pdfrecombinant drugs.pdf
recombinant drugs.pdfssuser1703a8
 
Marios_Stylianou_PhD thesis
Marios_Stylianou_PhD thesisMarios_Stylianou_PhD thesis
Marios_Stylianou_PhD thesisMarios Stylianou
 
Replication Competent IAV and IBV with Timer Article.PDF
Replication Competent IAV and IBV with Timer Article.PDFReplication Competent IAV and IBV with Timer Article.PDF
Replication Competent IAV and IBV with Timer Article.PDFMichael Breen
 
joURNAL READING BIOMARKER.pptx
joURNAL READING BIOMARKER.pptxjoURNAL READING BIOMARKER.pptx
joURNAL READING BIOMARKER.pptxjoganks1
 
HIV & AIDS- RAHUL SAHU
HIV & AIDS- RAHUL SAHUHIV & AIDS- RAHUL SAHU
HIV & AIDS- RAHUL SAHURahul Sahu
 
vaccins drug delivery system
vaccins drug delivery systemvaccins drug delivery system
vaccins drug delivery systemManish Jajodiya
 

Semelhante a Noi principii in vaccinare C Leclerc 2014 (20)

Types of Vaccinesproduced by cell culture methods.pptx
Types of Vaccinesproduced by cell culture methods.pptxTypes of Vaccinesproduced by cell culture methods.pptx
Types of Vaccinesproduced by cell culture methods.pptx
 
Presentation on conventional vaccine (Quality Control and Production aspects)
Presentation on conventional vaccine (Quality Control and Production aspects)Presentation on conventional vaccine (Quality Control and Production aspects)
Presentation on conventional vaccine (Quality Control and Production aspects)
 
Nisha revrse vaccinology
Nisha revrse vaccinology Nisha revrse vaccinology
Nisha revrse vaccinology
 
Vaccine against viruses
Vaccine against virusesVaccine against viruses
Vaccine against viruses
 
Reecha Vaccine PPT !! (1).ppt
Reecha Vaccine PPT !! (1).pptReecha Vaccine PPT !! (1).ppt
Reecha Vaccine PPT !! (1).ppt
 
Parasite Vaccines in Trials and in Use
Parasite Vaccines in Trials and in UseParasite Vaccines in Trials and in Use
Parasite Vaccines in Trials and in Use
 
Mci5004 biomarkers infectious diseases
Mci5004 biomarkers infectious diseasesMci5004 biomarkers infectious diseases
Mci5004 biomarkers infectious diseases
 
IMMUNIZATION LECTURE.ppt
IMMUNIZATION LECTURE.pptIMMUNIZATION LECTURE.ppt
IMMUNIZATION LECTURE.ppt
 
Vaccination
VaccinationVaccination
Vaccination
 
Immunization with sars coronavirus vaccines leads to pulmonary immunopathology
Immunization with sars coronavirus vaccines leads to pulmonary immunopathologyImmunization with sars coronavirus vaccines leads to pulmonary immunopathology
Immunization with sars coronavirus vaccines leads to pulmonary immunopathology
 
Vaccination
VaccinationVaccination
Vaccination
 
recombinant drugs.pdf
recombinant drugs.pdfrecombinant drugs.pdf
recombinant drugs.pdf
 
Marios_Stylianou_PhD thesis
Marios_Stylianou_PhD thesisMarios_Stylianou_PhD thesis
Marios_Stylianou_PhD thesis
 
Replication Competent IAV and IBV with Timer Article.PDF
Replication Competent IAV and IBV with Timer Article.PDFReplication Competent IAV and IBV with Timer Article.PDF
Replication Competent IAV and IBV with Timer Article.PDF
 
Human parasite vaccines
Human parasite vaccinesHuman parasite vaccines
Human parasite vaccines
 
joURNAL READING BIOMARKER.pptx
joURNAL READING BIOMARKER.pptxjoURNAL READING BIOMARKER.pptx
joURNAL READING BIOMARKER.pptx
 
1.6 marc lecuit
1.6 marc lecuit1.6 marc lecuit
1.6 marc lecuit
 
HIV & AIDS- RAHUL SAHU
HIV & AIDS- RAHUL SAHUHIV & AIDS- RAHUL SAHU
HIV & AIDS- RAHUL SAHU
 
vaccins drug delivery system
vaccins drug delivery systemvaccins drug delivery system
vaccins drug delivery system
 
Newer vaccines.pptx
Newer vaccines.pptxNewer vaccines.pptx
Newer vaccines.pptx
 

Mais de Avocat Delia Maria Cobzariu

Mais de Avocat Delia Maria Cobzariu (7)

IELTS prin CYF Medical
IELTS prin CYF MedicalIELTS prin CYF Medical
IELTS prin CYF Medical
 
Dirofilaria ghid de diagnostic 3
Dirofilaria  ghid de diagnostic 3Dirofilaria  ghid de diagnostic 3
Dirofilaria ghid de diagnostic 3
 
Simpozion dirofilaria prezentare generala2013 1
Simpozion dirofilaria prezentare generala2013 1Simpozion dirofilaria prezentare generala2013 1
Simpozion dirofilaria prezentare generala2013 1
 
FeLV si FIV Boli pisici an 5 curs Diagnostic si Profilaxie
FeLV si FIV Boli pisici an 5 curs Diagnostic si ProfilaxieFeLV si FIV Boli pisici an 5 curs Diagnostic si Profilaxie
FeLV si FIV Boli pisici an 5 curs Diagnostic si Profilaxie
 
Boli infectioase ale Cainilor Note de Curs Diagnostic si Profilaxie
Boli infectioase ale Cainilor Note de Curs Diagnostic si ProfilaxieBoli infectioase ale Cainilor Note de Curs Diagnostic si Profilaxie
Boli infectioase ale Cainilor Note de Curs Diagnostic si Profilaxie
 
Panleucopenia felina Boli Infectioase Diagnostic si Profilaxie
Panleucopenia felina Boli Infectioase Diagnostic si Profilaxie Panleucopenia felina Boli Infectioase Diagnostic si Profilaxie
Panleucopenia felina Boli Infectioase Diagnostic si Profilaxie
 
Curs an 5 pisici herpes si calici viroze
Curs an 5 pisici herpes si calici virozeCurs an 5 pisici herpes si calici viroze
Curs an 5 pisici herpes si calici viroze
 

Último

Role Of Transgenic Animal In Target Validation-1.pptx
Role Of Transgenic Animal In Target Validation-1.pptxRole Of Transgenic Animal In Target Validation-1.pptx
Role Of Transgenic Animal In Target Validation-1.pptxNikitaBankoti2
 
Unit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxUnit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxVishalSingh1417
 
Python Notes for mca i year students osmania university.docx
Python Notes for mca i year students osmania university.docxPython Notes for mca i year students osmania university.docx
Python Notes for mca i year students osmania university.docxRamakrishna Reddy Bijjam
 
1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdfQucHHunhnh
 
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptxMaritesTamaniVerdade
 
ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.MaryamAhmad92
 
Measures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeMeasures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeThiyagu K
 
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17  How to Extend Models Using Mixin ClassesMixin Classes in Odoo 17  How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin ClassesCeline George
 
Unit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptxUnit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptxVishalSingh1417
 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...EduSkills OECD
 
Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfPoh-Sun Goh
 
Grant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy ConsultingGrant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy ConsultingTechSoup
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxDenish Jangid
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxVishalSingh1417
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdfQucHHunhnh
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhikauryashika82
 
The basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxThe basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxheathfieldcps1
 
This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.christianmathematics
 

Último (20)

Role Of Transgenic Animal In Target Validation-1.pptx
Role Of Transgenic Animal In Target Validation-1.pptxRole Of Transgenic Animal In Target Validation-1.pptx
Role Of Transgenic Animal In Target Validation-1.pptx
 
Unit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptxUnit-IV; Professional Sales Representative (PSR).pptx
Unit-IV; Professional Sales Representative (PSR).pptx
 
Python Notes for mca i year students osmania university.docx
Python Notes for mca i year students osmania university.docxPython Notes for mca i year students osmania university.docx
Python Notes for mca i year students osmania university.docx
 
1029-Danh muc Sach Giao Khoa khoi 6.pdf
1029-Danh muc Sach Giao Khoa khoi  6.pdf1029-Danh muc Sach Giao Khoa khoi  6.pdf
1029-Danh muc Sach Giao Khoa khoi 6.pdf
 
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx
2024-NATIONAL-LEARNING-CAMP-AND-OTHER.pptx
 
ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.
 
Measures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeMeasures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and Mode
 
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17  How to Extend Models Using Mixin ClassesMixin Classes in Odoo 17  How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
 
Unit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptxUnit-IV- Pharma. Marketing Channels.pptx
Unit-IV- Pharma. Marketing Channels.pptx
 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
 
Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdf
 
Grant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy ConsultingGrant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy Consulting
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
 
Asian American Pacific Islander Month DDSD 2024.pptx
Asian American Pacific Islander Month DDSD 2024.pptxAsian American Pacific Islander Month DDSD 2024.pptx
Asian American Pacific Islander Month DDSD 2024.pptx
 
Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptx
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
 
The basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptxThe basics of sentences session 3pptx.pptx
The basics of sentences session 3pptx.pptx
 
This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.
 

Noi principii in vaccinare C Leclerc 2014

  • 1. Nouvelles perspectives en vaccinologie AAEIP, Université Paris Sud, 31 Mars 2014 Claude Leclerc
  • 2. DEVELOPPEMENT of HUMAN VACCINES Live attenuated vaccines Genetically engieneered Purified protein or polysaccharide Killed vaccines Smallpox, 1798 Rabies, 1885 BCG, 1927 Yellow fever, 1935 Polio (oral) Measles Mumps Rubella Adenovirus Typhoid (Ty21a) Varicella Rotavirus Diphteria, 1923 Tetanus, 1927 Pneumococcus Meningococcus Haemophilus influenzae PRP Hepatitis B (plasma derived) Tick-birne encephalitis H. influenzae PRP conjugate Typhoid (Vi) Acellular pertussis Typhoid 1896 Cholera, 1896 Plague, 1897 Pertussis, 1926 (killed bacteria) Influenza, 1936 Rickettsia, 1938 Polio (injected) Rabies (new) Japanese Encephalitis Hepatitis A Hepatitis B (recombinant) Human Papilloma virus Rotavirus 18th Century 19th Century Early 20th Century After World War II (cellular culture)
  • 3. Vaccines have been made for 36 of >400 human pathogens Immunological Bioinformatics, The MIT press. +HPV & Rotavirus
  • 4. The different types of vaccines Attenuated Vaccines Killed Vaccines Acellular sub- unit vaccines Pertussis Diphteria Hepatitis B Tetanus Cholera Pertussis Hepatitis A Polio Polio Yellow fever BCG
  • 5. New and improved technologies and resulting vaccines R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 6. New and improved technologies and resulting vaccines R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 7. New and improved technologies and resulting vaccines R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 8. New and improved technologies and resulting vaccines R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 9. New and improved technologies and resulting vaccines R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 10. R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 11. R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 13. Nature Reviews Microbiology 2010 Dengue vaccines under development
  • 14. Dengue vaccines under development Sanofi Pasteur dengue vaccine enters phase III clinical study in October 2010
  • 15. The yellow fever 17D virus as a platform for new live attenuated vaccines
  • 16.
  • 17. Worldwide map of phase II/III dengue clinical trials, and major results obtained so far in humans Guy et al, Vaccine, 2011, 7229-7241
  • 18. Lancet, Published Online, September 11, 2012
  • 19. Serotype-specific and overall efficacy of CYD tetravalent dengue vaccine against virologically confirmed dengue disease
  • 20.
  • 21. Reverse cumulative distribution of serotype-specific PRNT 50 antibody titres curves for DENV serotypes 1–4 by baseline FV-serostatus, pre-vaccination and after two and three doses of CYD-TDV (Full Analysis Set). Vaccine, Volume 31, 2013, 5814 - 5821
  • 23. R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 24. Schematic representation of the CSP and the RTS,S vaccine P D. Crompton, SK. Pierce, L H. Miller J Clin Invest. 2010
  • 25.
  • 26. Malaria cuts risk in half in late-stage trial H Waters Nature Medicine Nov 2011
  • 27. N Eng J Med 2012
  • 28. Malaria cuts risk in half in late-stage trial H Waters Nature Medicine Nov 2011 31%
  • 29.
  • 30.
  • 31. R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 32. How to discover protective antigens?
  • 33. Identification of new target antigens: impact of genomics Whole genome sequences of most bacterial pathogens and parasites completed E. coli K-12 B. burgdorferi B. subtilis M. tuberculosis R. prowazekii H. influenzae C. pneumoniae C. trachomatis N. gonorrhoeae S. aureus H. pylori P. horikoshü E. faecalis N. meningitidis S. epidermitis M. genitalium S. pneumoniae L. pneumophila P. falciparum S. pyogenes M. pneumoniae T. pallidum L. major P. aeruginosa T. cruzi M. leprae P. aerophilum V. cholerae
  • 34. Genomic-based vaccine development Whole genomic sequence Computer prediction Expression of recombinant proteins DNA preparation In silico vaccine candidates Immunogenicity testing in animal models Vaccine development
  • 35. 600 potential vaccine candidates identified 350 proteins successfully expressed in E.coli 344 proteins purified and used to immunize mice 355 sera tested 91 novel surface-exposed proteins identified 28 novel proteins have bactericidal activity Meningoccocal B Vaccine: A Genomic Approach 5 vaccine candidates Rappuoli et al, 2002 Clinical trials
  • 36.
  • 38. R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 40. A new computational method to design epitope-focused vaccines, illustrated with a neutralization epitope from RSV  Nature 507, 201–206 (13 March 2014)
  • 41. Nature 507, 201–206 (13 March 2014) Induction of neutralizating antibodies against RSV
  • 42. R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 43. Overview of the problems and methodologies of systems vaccinology Seminars in Immunology, 2013, 209 - 218
  • 44.
  • 45.
  • 46. R Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Published online 4 November 2011
  • 47. Alum adjuvants are non-cystalline gels based on aluminum oxyhydroxide (referred to as Aluminum hydroxide gel), aluminum hydroxyphosphate (referred to as aluminum phosphate gel) or various proprietary salts such as aluminum hydroxy- sulfate) Alum is used in several licensed vaccines including: •  diphtheria-pertusis-tetanus •  diphtheria-tetanus (DT) •  DT combined with Hepatitis B (HBV) •  Haemophilus influenza B •  inactivated polio virus •  Hepatitis A (HAV) •  Streptoccucus pneumonia •  Menngococccal •  Human papilloma virus (HPV) Vaccines containing Alum Adjuvant
  • 48. Dendritic cells initiate antigen-specific immune responses •  most efficient of all APCs •  high MHC class I, II & costimulators •  efficient cross presentation •  stimulate naïve T cells (CD4, CD8) All immunization strategies must target DCs Initiate Ag-specific immune responses
  • 49. Multiple inducers of DC maturation Immature DC Mature DC various T cell responses Microbial products / TLR ligands Viral products Inflammatory cytokines Signaling receptors
  • 50. Antigen-presenting cells serve as the bridge between innate and antigen-specific responses 2003, 2, 727-735
  • 51. Rappuoli, CW. Mandl, S Black & E De Gregorio Nature Reviews Immunology Nov 2011 Vaccine adjuvants
  • 54. T cell differentiation pathways Coomes S M et al. Open Biol. 2013;3:120157 ©2013 by The Royal Society
  • 55. Therapeutic vaccines for chronic infections or cancers
  • 56. Cancer, a worldwide burden  1st cause of mortality in France  In Europ, in 2012: - 1.75 million deaths from cancer -  3.45 million new cases of cancer  In the world, in 2012: - 8.2 millions deaths - 14 million new cases diagnosed
  • 57. Cancer, a cell disease uncontrolled proliferation Tumor Surgery ChimiotherapyRadiotherapy Anti-angiogenic drugs
  • 58. Immune responses can control the growth of tumor cells The immunosurveillance theory “It is by no means inconceivable that small accumulations of tumour cells may develop and because of their possession of new antigenic potentialities provoke an effective immunological reaction, with regression of the tumor and no clinical hint of its existence” British Med Journal, April 1957Burnet
  • 59. Tumor specific/associated antigens Overexpressed self antigens Differentiation antigens Mutated self antigens Non self oncoviral antigens Altered self antigens: Abnormal post- translational/ transcriptional modification: underglycosylation
  • 60. The concept of therapeutic anti-cancer vaccines   Induction of specific immune responses against tumor specific/associated antigens to kill tumor cells or prevent their growth without affecting normal cells
  • 61. Tumor vaccines - Whole tumor cells: + BCG or DETOX, e.g. Melacine vaccine (cell lysates), CancerVax ( irradiated melanoma cell lines), M-Vax (hapten-treated autologous cells) and gene- modified, irradiated tumor cells (GM-CSF) - Tumor antigens: MAGE-1, MAGE-3, MART-1/Melan-A, tyrosinase, gp100, MUC-1, CEA, etc. - Peptide vaccines: mutated ras, mutated p53, Her-2/neu, MART -1, gp100, MUC-1 - Heat shock proteins - DNA vaccines - Dendritic cell vaccines
  • 62. Response rate = 3. 8% Current human cancer vaccines show very low objective clinical response rate Rosenberg, Yang & Restifo Nature Med 10:909 (2004)
  • 63. Response rate = 3. 8% Current human cancer vaccines show very low objective clinical response rate Rosenberg, Yang & Restifo Nature Med (2004) Benefit of passive immunotherapy (antibodies) in cancer patients Lack of efficacy of most current therapeutic cancer vaccines
  • 64. Problems Tumor derived antigens are weakly immunogenic Need for better adjuvants or immunisation strategies
  • 65. Dendritic cells initiate antigen-specific immune responses •  most efficient of all antigen-presenting cells •  stimulate naïve T cells (CD4, CD8) All immunization strategies must target DCs
  • 66. An Approach to Initiating Immunity to Cancer: Dendritic Cells Loaded with Tumor Antigens ex vivo DC precursors expanded immature DCs add disease- related antigens maturing DCs presenting antigen(s) Tumor- specific T cells responding to dendritic cells
  • 67. 2010: FDA panel passes first cancer vaccine
  • 68. Original Article Sipuleucel-T Immunotherapy for Castration- Resistant Prostate Cancer Philip W. Kantoff, M.D., Celestia S. Higano, M.D., Neal D. Shore, M.D., E. Roy Berger, M.D., Eric J. Small, M.D., David F. Penson, M.D., Charles H. Redfern, M.D., Anna C. Ferrari, M.D., Robert Dreicer, M.D., Robert B. Sims, M.D., Yi Xu, Ph.D., Mark W. Frohlich, M.D., Paul F. Schellhammer, M.D., for the IMPACT Study Investigators N Engl J Med Volume 363(5):411-422 July 29, 2010
  • 69.
  • 73.
  • 74.
  • 75. Problems Tumor derived antigens are weakly immunogenic Need for better adjuvants or immunisation strategies
  • 76. CD8+ T cell CD4+ T cell Dendritic cell Induction of optimized T cell responses by in vivo dendritic cells targeting Antigen targeting Maturation signals 2 1 Adjuvant
  • 77. CyaA: a new proteinic vector targeted to dendritic cells Bordetella pertussis Dermonecrotic Toxin BrkA FHA TCF FIM TCT Pertussis Toxin cAMP Pertactin Adenylate cyclase Toxin Dendritic Cell CD11b/CD18 AC domain RTX domain 1 400 1706 Internalization Endosomes Cytosol CyaA binds to CD11b allowing efficient targeting to dendritic cells Guermonprez et al, J. Exp. Med, 2001 Adenylate cyclase (CyaA)
  • 78. Recombinant CyaA + Activation of CD8+ Cytotoxic T lymphocytes Dendritic Cell ϕ CD11b/CD18 Antigen Th CD4+ MHC-II endosomes lysosomes ϕ ϕ MHC class II presentation Activation of CD4+ Helper T lymphocytes MHC class I presentation Endoplasmic Reticulum CTL CD8+ MHC-I/β2 ϕ Translocation Endocytosis Antigens grafted in CyaA are delivered to both MHC class I & MHC class II presentation pathways
  • 79. Immunisation in mice and non-human primates by recombinant CyaA carrying a variety of antigens (such as from M. tuberculosis or HIV) stimulates strong CTL and Th1 responses, even in the absence of adjuvant. Préville et al, Cancer Res, 2005, Mascarell et al, J. Virol 2005, Majlessi et al, Inf Immun, 2005, Hervas-Stubb et al, Inf Immun, 2006, Mascarell et al, Vaccine 2006, Berraondo et al, Cancer Res, 2007, Fayolle et al, Vaccine 2010. CyaA: a new proteinic vector targeted to dendritic cells
  • 80. 80 HPV infection life cycle Few months to few years Up to 20 years Goodman A., Wilbur D. C.
  • 82. - The HPV E6 and E7 oncoproteins are expressed throughout the replicative cycle of the virus and are necessary for the onset and maintenance of malignant transformation. - HPV E6 and E7 antigens are potential targets for specific immunotherapy. Rational
  • 83. MHGDTPTLHEYMLDLQPETTDLYCYEQLN CyaAE5 GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP CyaA-E7∆30-42 Catalytic domain 224 235 319 320 1 400 1706 LQ LQ Recombinant CyaA carrying E7 from HPV16 GMP batch produced in recombinant E. coli
  • 84. Therapeutic vaccination with recombinant HPV16-E7 CyaAs eradicates established tumors No treatment CyaA-OVA 0 500 1000 1500 2000 0 10 5/5 10/10 0/10 20 30 40 50 60 70 80 90 0 500 1000 1500 2000 CyaA-HPV16E7∆30-42 - Graft of TC-1 cells at day 0 - At day 10, one injection of: - 50 µg of CyaA-E7 or of control CyaA-OVA Preville et al, Cancer Res. 2005; Berraondo, K. et al. Cancer Res. 2007
  • 85. A therapeutic vaccine candidate against HPV chronic infection and/or cervical cancer Clinical trials started in 2010 0 102030405060708090 0 500 1000 1500 2000 0 102030405060708090 0 500 1000 1500 2000 0 102030405060708090100 0 20 40 60 80 100 0 5 10 15 20 25 30 35 0.0 0.2 10 20 daysdays days CyaAE5 HPV16E7∆30-42CyaAE5 CysOVA Controls One injection at Day 10 CyaAE5 HPV16E7∆30-42 Préville et al, Cancer Res, 2005
  • 87. Merci de votre attention ! claude.leclerc@pasteur.fr