SlideShare a Scribd company logo
1 of 16
Breeding and genomics in ILRI biosciences
research
Steve Kemp
ILRI BioSciences Day, Nairobi, 27 November 2013
Livestock diversity
Livestock diversity

Genome sequence
determines characteristics:
• Disease resistance
• Drought tolerance
• Productivity
Livestock diversity
Genome sequence MOSTLY determines
characteristics, but what determines
productivity in a given system?
•
•
•
•

Genetics ?
Feed ?
Health ?
Management ?

That is a meaningless
question!
Disease resistance

Boran

N’Dama

Bovins
Cattle
Glossines
Tsetse
Bovins et Glossines
Cattle and tsetse
Contribution of 10 genes from Boran and N’Dama
cattle to reduction in degree of trypanosomosis
Boran (relatively susceptible)

15
10
5
0
-5
-10
-15

N’Dama (tolerant)

15
10
5
0
-5
-10
-15

The N’Dama and Boran each contribute trypanotolerance alleles at 5
of the 10 most significant QTL, indicating that a synthetic breed could
have even higher tolerance than the N’Dama.
Alignment of N’Dama ARHGAP15 with
homologues
H

P mutation at AA282

Cow NDama
KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK
Cow Boran
KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK

Human
KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK
Pig
Chicken

KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK
KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER

Salmon
KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK
N'Dama (n = 35) Boran (n = 28)
Gene frequency
282P-Allele
0.990
0.125
282H-Allele
0.010
0.875
Alignment of N’Dama ARHGAP15 with
homologues
That mutationof AA282
H
P piece at work

took a lot of time and money.

Cow NDama
What has it really achieved?
KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK
Cow Boran
KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK

Human
KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK
Pig
Chicken

KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK
KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER

Salmon
KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK
N'Dama (n = 35) Boran (n = 28)
Gene frequency
282P-Allele
0.990
0.125
282H-Allele
0.010
0.875
The technology behind such ‘gene discovery’ has
been transformed
The technology behind such ‘gene discovery’ has
been transformed
The technology behind ‘gene delivery’ has NOT
been transformed
It is not rocket science!
But that does not mean it is easy..
…and we need a complete pipeline
The pipeline is therefore incomplete
Genome sequence is now easy to obtain.

Phenotype information is now HARDER to obtain.
We need both.
The technology behind ‘gene delivery’ has NOT
(entirely) been transformed
TALENS technology.

Is somewhere along that pipeline and allows us to perform
‘precision crossbreeding’, or gene editing.
We can now swap alleles at 100 genes in one go.
But we don’t have 100 candidate SNPs, because the
pipeline is dry.

But we do have 2!
We need to re-establish a genetics pipeline.
We need to re-establish a genetics pipeline
Sequence

Conserve
Phenotype
Function

Deliver to an animal
Deliver to the user

What traits?
What species?
What breeds?
What target systems?
Where to look for
variation?
Livestock diversity

A cow is mostly non-cow:
•Rumen sequence PARTLY
Genome
•Skin
determines characteristics:
•Milk
• Disease resistance
•Soil
• Drought tolerance
• Productivity
Metagenomes play a role and interact
with each other.
So ‘describing a cow, suddenly became
much more fun.

More Related Content

What's hot

Research Symposium Poster Draft
Research Symposium Poster DraftResearch Symposium Poster Draft
Research Symposium Poster DraftSara Nass
 
Tyler impact next gen fri 0900
Tyler impact next gen fri 0900Tyler impact next gen fri 0900
Tyler impact next gen fri 0900Sucheta Tripathy
 
Farm animals in aquatic systems - Anna Troedsson-Wargelius
Farm animals in aquatic systems - Anna Troedsson-WargeliusFarm animals in aquatic systems - Anna Troedsson-Wargelius
Farm animals in aquatic systems - Anna Troedsson-WargeliusOECD Environment
 
Heritability for yield and glycoalkaloid content in potato breeding for heat ...
Heritability for yield and glycoalkaloid content in potato breeding for heat ...Heritability for yield and glycoalkaloid content in potato breeding for heat ...
Heritability for yield and glycoalkaloid content in potato breeding for heat ...African Potato Association (APA)
 
An overview of agricultural applications of genome editing: Farm animals
An overview of agricultural applications of genome editing: Farm animals An overview of agricultural applications of genome editing: Farm animals
An overview of agricultural applications of genome editing: Farm animals OECD Environment
 
Introgression and the origin of maize in Mexico and the Southwest US
Introgression and the origin of maize in Mexico and the Southwest USIntrogression and the origin of maize in Mexico and the Southwest US
Introgression and the origin of maize in Mexico and the Southwest USjrossibarra
 
Beyond GWAS QTL Identification and Strategies to Increase Yield
Beyond GWAS QTL Identification and Strategies to Increase YieldBeyond GWAS QTL Identification and Strategies to Increase Yield
Beyond GWAS QTL Identification and Strategies to Increase YieldKate Barlow
 
Complex adaptation in Zea
Complex adaptation in ZeaComplex adaptation in Zea
Complex adaptation in Zeajrossibarra
 
Resource use efficiency in livestock: Bridging the biotechnology-livestock pr...
Resource use efficiency in livestock: Bridging the biotechnology-livestock pr...Resource use efficiency in livestock: Bridging the biotechnology-livestock pr...
Resource use efficiency in livestock: Bridging the biotechnology-livestock pr...ExternalEvents
 
Microevolution & mutation pressure
Microevolution & mutation pressureMicroevolution & mutation pressure
Microevolution & mutation pressureTauqeer Ahmad
 
Genomic Selection in Dairy Cattle
Genomic Selection in Dairy CattleGenomic Selection in Dairy Cattle
Genomic Selection in Dairy CattleJohn B. Cole, Ph.D.
 

What's hot (20)

Research Symposium Poster Draft
Research Symposium Poster DraftResearch Symposium Poster Draft
Research Symposium Poster Draft
 
Mutation pressure
Mutation pressureMutation pressure
Mutation pressure
 
Tyler impact next gen fri 0900
Tyler impact next gen fri 0900Tyler impact next gen fri 0900
Tyler impact next gen fri 0900
 
Farm animals in aquatic systems - Anna Troedsson-Wargelius
Farm animals in aquatic systems - Anna Troedsson-WargeliusFarm animals in aquatic systems - Anna Troedsson-Wargelius
Farm animals in aquatic systems - Anna Troedsson-Wargelius
 
Ecogen2013
Ecogen2013Ecogen2013
Ecogen2013
 
Monday theme 1 1400 1415 large briefing room manuel
Monday theme 1 1400 1415 large briefing room manuelMonday theme 1 1400 1415 large briefing room manuel
Monday theme 1 1400 1415 large briefing room manuel
 
Heritability for yield and glycoalkaloid content in potato breeding for heat ...
Heritability for yield and glycoalkaloid content in potato breeding for heat ...Heritability for yield and glycoalkaloid content in potato breeding for heat ...
Heritability for yield and glycoalkaloid content in potato breeding for heat ...
 
Toronto 2015
Toronto 2015Toronto 2015
Toronto 2015
 
CRISPRfrancesca
CRISPRfrancescaCRISPRfrancesca
CRISPRfrancesca
 
Mutation pressure
Mutation pressureMutation pressure
Mutation pressure
 
Mekuria's poster
Mekuria's posterMekuria's poster
Mekuria's poster
 
Muldoon.B poster final
Muldoon.B poster finalMuldoon.B poster final
Muldoon.B poster final
 
An overview of agricultural applications of genome editing: Farm animals
An overview of agricultural applications of genome editing: Farm animals An overview of agricultural applications of genome editing: Farm animals
An overview of agricultural applications of genome editing: Farm animals
 
Danforth 2015
Danforth 2015Danforth 2015
Danforth 2015
 
Introgression and the origin of maize in Mexico and the Southwest US
Introgression and the origin of maize in Mexico and the Southwest USIntrogression and the origin of maize in Mexico and the Southwest US
Introgression and the origin of maize in Mexico and the Southwest US
 
Beyond GWAS QTL Identification and Strategies to Increase Yield
Beyond GWAS QTL Identification and Strategies to Increase YieldBeyond GWAS QTL Identification and Strategies to Increase Yield
Beyond GWAS QTL Identification and Strategies to Increase Yield
 
Complex adaptation in Zea
Complex adaptation in ZeaComplex adaptation in Zea
Complex adaptation in Zea
 
Resource use efficiency in livestock: Bridging the biotechnology-livestock pr...
Resource use efficiency in livestock: Bridging the biotechnology-livestock pr...Resource use efficiency in livestock: Bridging the biotechnology-livestock pr...
Resource use efficiency in livestock: Bridging the biotechnology-livestock pr...
 
Microevolution & mutation pressure
Microevolution & mutation pressureMicroevolution & mutation pressure
Microevolution & mutation pressure
 
Genomic Selection in Dairy Cattle
Genomic Selection in Dairy CattleGenomic Selection in Dairy Cattle
Genomic Selection in Dairy Cattle
 

Viewers also liked

New Tools for Genomic Selection of Livestock
New Tools for Genomic Selection of LivestockNew Tools for Genomic Selection of Livestock
New Tools for Genomic Selection of LivestockJohn B. Cole, Ph.D.
 
Genomic selection with weighted GBLUP and APY single step
Genomic selection with weighted GBLUP and APY single stepGenomic selection with weighted GBLUP and APY single step
Genomic selection with weighted GBLUP and APY single stepILRI
 
Tiger population genetics
Tiger population geneticsTiger population genetics
Tiger population geneticsPhilippe Henry
 
Genomic selection in small holder systems: Challenges and opportunities
Genomic selection in small holder systems: Challenges and opportunitiesGenomic selection in small holder systems: Challenges and opportunities
Genomic selection in small holder systems: Challenges and opportunitiesILRI
 
Heat tolerance, real-life genomics and GxE issues
Heat tolerance, real-life genomics and GxE issuesHeat tolerance, real-life genomics and GxE issues
Heat tolerance, real-life genomics and GxE issuesILRI
 
Monteiro 2015 Conservação ex situ de espécies ameaçadas da flora brasileira: ...
Monteiro 2015 Conservação ex situ de espécies ameaçadas da flora brasileira: ...Monteiro 2015 Conservação ex situ de espécies ameaçadas da flora brasileira: ...
Monteiro 2015 Conservação ex situ de espécies ameaçadas da flora brasileira: ...José André
 
Different animal projects in india as launched by govt. of India
Different animal projects in india as launched by govt. of IndiaDifferent animal projects in india as launched by govt. of India
Different animal projects in india as launched by govt. of IndiaMeentu Prakash
 
Applications of Biotechnology in Animal Health
             Applications of Biotechnology in Animal Health             Applications of Biotechnology in Animal Health
Applications of Biotechnology in Animal HealthRajashekar Baldhu
 
Chicken phenoypic and genetic diversity: Where does it come from
Chicken phenoypic and genetic diversity: Where does it come from  Chicken phenoypic and genetic diversity: Where does it come from
Chicken phenoypic and genetic diversity: Where does it come from ILRI
 
Whole genome sequencing of bacteria & analysis
Whole genome sequencing of bacteria & analysisWhole genome sequencing of bacteria & analysis
Whole genome sequencing of bacteria & analysisdrelamuruganvet
 
sequencing of genome
sequencing of genomesequencing of genome
sequencing of genomeNaveen Gupta
 
IMPACT OF BIOTECHNOLOGY ON ANIMAL BREEDING AND GENETIC PROGRESS
IMPACT OF BIOTECHNOLOGY ON ANIMAL BREEDING AND GENETIC PROGRESSIMPACT OF BIOTECHNOLOGY ON ANIMAL BREEDING AND GENETIC PROGRESS
IMPACT OF BIOTECHNOLOGY ON ANIMAL BREEDING AND GENETIC PROGRESSDepartment of Animal Production
 
The Second Report on the State of the World’s Animal Genetics Resources for F...
The Second Report on the State of the World’s Animal Genetics Resources for F...The Second Report on the State of the World’s Animal Genetics Resources for F...
The Second Report on the State of the World’s Animal Genetics Resources for F...FAO
 
Genomic Selection & Precision Phenotyping
Genomic Selection & Precision PhenotypingGenomic Selection & Precision Phenotyping
Genomic Selection & Precision PhenotypingCIMMYT
 
Whole Genome Selection
Whole Genome SelectionWhole Genome Selection
Whole Genome SelectionRaghav N.R
 
Methods for characterization of animal genomes(snp,str,qtl,rflp,rapd)
Methods for characterization of animal genomes(snp,str,qtl,rflp,rapd)Methods for characterization of animal genomes(snp,str,qtl,rflp,rapd)
Methods for characterization of animal genomes(snp,str,qtl,rflp,rapd)Dr Vijayata choudhary
 
S4.4 Doubled Haploid Technology in Maize breeding: Status and prospects
S4.4  Doubled Haploid Technology in Maize breeding: Status and prospectsS4.4  Doubled Haploid Technology in Maize breeding: Status and prospects
S4.4 Doubled Haploid Technology in Maize breeding: Status and prospectsCIMMYT
 

Viewers also liked (20)

New Tools for Genomic Selection of Livestock
New Tools for Genomic Selection of LivestockNew Tools for Genomic Selection of Livestock
New Tools for Genomic Selection of Livestock
 
Genomic selection with weighted GBLUP and APY single step
Genomic selection with weighted GBLUP and APY single stepGenomic selection with weighted GBLUP and APY single step
Genomic selection with weighted GBLUP and APY single step
 
Tiger population genetics
Tiger population geneticsTiger population genetics
Tiger population genetics
 
Genomic selection in small holder systems: Challenges and opportunities
Genomic selection in small holder systems: Challenges and opportunitiesGenomic selection in small holder systems: Challenges and opportunities
Genomic selection in small holder systems: Challenges and opportunities
 
Heat tolerance, real-life genomics and GxE issues
Heat tolerance, real-life genomics and GxE issuesHeat tolerance, real-life genomics and GxE issues
Heat tolerance, real-life genomics and GxE issues
 
Monteiro 2015 Conservação ex situ de espécies ameaçadas da flora brasileira: ...
Monteiro 2015 Conservação ex situ de espécies ameaçadas da flora brasileira: ...Monteiro 2015 Conservação ex situ de espécies ameaçadas da flora brasileira: ...
Monteiro 2015 Conservação ex situ de espécies ameaçadas da flora brasileira: ...
 
Different animal projects in india as launched by govt. of India
Different animal projects in india as launched by govt. of IndiaDifferent animal projects in india as launched by govt. of India
Different animal projects in india as launched by govt. of India
 
Applications of Biotechnology in Animal Health
             Applications of Biotechnology in Animal Health             Applications of Biotechnology in Animal Health
Applications of Biotechnology in Animal Health
 
Chicken phenoypic and genetic diversity: Where does it come from
Chicken phenoypic and genetic diversity: Where does it come from  Chicken phenoypic and genetic diversity: Where does it come from
Chicken phenoypic and genetic diversity: Where does it come from
 
Genome analysis
Genome analysisGenome analysis
Genome analysis
 
Whole genome sequencing of bacteria & analysis
Whole genome sequencing of bacteria & analysisWhole genome sequencing of bacteria & analysis
Whole genome sequencing of bacteria & analysis
 
Genomic library
Genomic libraryGenomic library
Genomic library
 
sequencing of genome
sequencing of genomesequencing of genome
sequencing of genome
 
IMPACT OF BIOTECHNOLOGY ON ANIMAL BREEDING AND GENETIC PROGRESS
IMPACT OF BIOTECHNOLOGY ON ANIMAL BREEDING AND GENETIC PROGRESSIMPACT OF BIOTECHNOLOGY ON ANIMAL BREEDING AND GENETIC PROGRESS
IMPACT OF BIOTECHNOLOGY ON ANIMAL BREEDING AND GENETIC PROGRESS
 
The Second Report on the State of the World’s Animal Genetics Resources for F...
The Second Report on the State of the World’s Animal Genetics Resources for F...The Second Report on the State of the World’s Animal Genetics Resources for F...
The Second Report on the State of the World’s Animal Genetics Resources for F...
 
Genomic Selection & Precision Phenotyping
Genomic Selection & Precision PhenotypingGenomic Selection & Precision Phenotyping
Genomic Selection & Precision Phenotyping
 
Whole Genome Selection
Whole Genome SelectionWhole Genome Selection
Whole Genome Selection
 
Methods for characterization of animal genomes(snp,str,qtl,rflp,rapd)
Methods for characterization of animal genomes(snp,str,qtl,rflp,rapd)Methods for characterization of animal genomes(snp,str,qtl,rflp,rapd)
Methods for characterization of animal genomes(snp,str,qtl,rflp,rapd)
 
Conservation of breeds ppt
Conservation of breeds pptConservation of breeds ppt
Conservation of breeds ppt
 
S4.4 Doubled Haploid Technology in Maize breeding: Status and prospects
S4.4  Doubled Haploid Technology in Maize breeding: Status and prospectsS4.4  Doubled Haploid Technology in Maize breeding: Status and prospects
S4.4 Doubled Haploid Technology in Maize breeding: Status and prospects
 

Similar to Breeding and Genomics Research to Improve Livestock Productivity

Andrea Crisanti-Enfermedades transmitidas por vectores
Andrea Crisanti-Enfermedades transmitidas por vectoresAndrea Crisanti-Enfermedades transmitidas por vectores
Andrea Crisanti-Enfermedades transmitidas por vectoresFundación Ramón Areces
 
Genetics as a tool to improve flock health
Genetics as a tool to improve flock healthGenetics as a tool to improve flock health
Genetics as a tool to improve flock healthSusan Schoenian
 
MICROSATELITE Markers for LIVESTOCK Genetic DIVERSITY ANALYSES
MICROSATELITE Markers for LIVESTOCK Genetic DIVERSITY ANALYSESMICROSATELITE Markers for LIVESTOCK Genetic DIVERSITY ANALYSES
MICROSATELITE Markers for LIVESTOCK Genetic DIVERSITY ANALYSESKaran Veer Singh
 
PCSGA 2010
PCSGA 2010PCSGA 2010
PCSGA 2010lisa418
 
Genomics for African cattle challenges and opportunities: The East African sh...
Genomics for African cattle challenges and opportunities: The East African sh...Genomics for African cattle challenges and opportunities: The East African sh...
Genomics for African cattle challenges and opportunities: The East African sh...ILRI
 
Biosciences research at the International Livestock Research Institute (ILRI)
Biosciences research at the International Livestock Research Institute (ILRI)Biosciences research at the International Livestock Research Institute (ILRI)
Biosciences research at the International Livestock Research Institute (ILRI)ILRI
 
Dr. Sid Thakur - Antimicrobial Resistance: Do We Know Everything?
Dr. Sid Thakur - Antimicrobial Resistance: Do We Know Everything?Dr. Sid Thakur - Antimicrobial Resistance: Do We Know Everything?
Dr. Sid Thakur - Antimicrobial Resistance: Do We Know Everything?John Blue
 
Techniques of-biotechnology-mcclean-good
Techniques of-biotechnology-mcclean-goodTechniques of-biotechnology-mcclean-good
Techniques of-biotechnology-mcclean-goodana_isa_barbosa
 
Domestication, polyploidy and genomics of crops #PAGXXV Heslop-Harrison
Domestication, polyploidy and genomics of crops #PAGXXV Heslop-HarrisonDomestication, polyploidy and genomics of crops #PAGXXV Heslop-Harrison
Domestication, polyploidy and genomics of crops #PAGXXV Heslop-HarrisonPat (JS) Heslop-Harrison
 
Molecular applications in characterization and differentiation of sri lankan ...
Molecular applications in characterization and differentiation of sri lankan ...Molecular applications in characterization and differentiation of sri lankan ...
Molecular applications in characterization and differentiation of sri lankan ...ExternalEvents
 
Tilling & eco tilling indrajay delvadiya
Tilling & eco tilling indrajay delvadiyaTilling & eco tilling indrajay delvadiya
Tilling & eco tilling indrajay delvadiyaDr. Indrajay R. Delvadiya
 
Evidence of Evolution by Natural Selection - how basic evolutionary principal...
Evidence of Evolution by Natural Selection - how basic evolutionary principal...Evidence of Evolution by Natural Selection - how basic evolutionary principal...
Evidence of Evolution by Natural Selection - how basic evolutionary principal...Madison Elsaadi
 
Vision for livestock genetics in Africa
Vision for livestock genetics in AfricaVision for livestock genetics in Africa
Vision for livestock genetics in AfricaILRI
 

Similar to Breeding and Genomics Research to Improve Livestock Productivity (20)

Andrea Crisanti-Enfermedades transmitidas por vectores
Andrea Crisanti-Enfermedades transmitidas por vectoresAndrea Crisanti-Enfermedades transmitidas por vectores
Andrea Crisanti-Enfermedades transmitidas por vectores
 
Genetics as a tool to improve flock health
Genetics as a tool to improve flock healthGenetics as a tool to improve flock health
Genetics as a tool to improve flock health
 
Bliss
BlissBliss
Bliss
 
Final report mst 5
Final report mst 5Final report mst 5
Final report mst 5
 
Final report mst 5
Final report mst 5Final report mst 5
Final report mst 5
 
Genetics as a tool to improve flock health
Genetics as a tool to improve flock healthGenetics as a tool to improve flock health
Genetics as a tool to improve flock health
 
MICROSATELITE Markers for LIVESTOCK Genetic DIVERSITY ANALYSES
MICROSATELITE Markers for LIVESTOCK Genetic DIVERSITY ANALYSESMICROSATELITE Markers for LIVESTOCK Genetic DIVERSITY ANALYSES
MICROSATELITE Markers for LIVESTOCK Genetic DIVERSITY ANALYSES
 
Tips for Improving Lambing/Kidding Percentage
Tips for Improving Lambing/Kidding PercentageTips for Improving Lambing/Kidding Percentage
Tips for Improving Lambing/Kidding Percentage
 
PCSGA 2010
PCSGA 2010PCSGA 2010
PCSGA 2010
 
Genomics for African cattle challenges and opportunities: The East African sh...
Genomics for African cattle challenges and opportunities: The East African sh...Genomics for African cattle challenges and opportunities: The East African sh...
Genomics for African cattle challenges and opportunities: The East African sh...
 
Biosciences research at the International Livestock Research Institute (ILRI)
Biosciences research at the International Livestock Research Institute (ILRI)Biosciences research at the International Livestock Research Institute (ILRI)
Biosciences research at the International Livestock Research Institute (ILRI)
 
The value of EBVs for the US meat goat industry
The value of EBVs for the US meat goat industryThe value of EBVs for the US meat goat industry
The value of EBVs for the US meat goat industry
 
Dr. Sid Thakur - Antimicrobial Resistance: Do We Know Everything?
Dr. Sid Thakur - Antimicrobial Resistance: Do We Know Everything?Dr. Sid Thakur - Antimicrobial Resistance: Do We Know Everything?
Dr. Sid Thakur - Antimicrobial Resistance: Do We Know Everything?
 
Techniques of-biotechnology-mcclean-good
Techniques of-biotechnology-mcclean-goodTechniques of-biotechnology-mcclean-good
Techniques of-biotechnology-mcclean-good
 
Domestication, polyploidy and genomics of crops #PAGXXV Heslop-Harrison
Domestication, polyploidy and genomics of crops #PAGXXV Heslop-HarrisonDomestication, polyploidy and genomics of crops #PAGXXV Heslop-Harrison
Domestication, polyploidy and genomics of crops #PAGXXV Heslop-Harrison
 
Molecular applications in characterization and differentiation of sri lankan ...
Molecular applications in characterization and differentiation of sri lankan ...Molecular applications in characterization and differentiation of sri lankan ...
Molecular applications in characterization and differentiation of sri lankan ...
 
Tilling & eco tilling indrajay delvadiya
Tilling & eco tilling indrajay delvadiyaTilling & eco tilling indrajay delvadiya
Tilling & eco tilling indrajay delvadiya
 
Homozygous Alleles
Homozygous AllelesHomozygous Alleles
Homozygous Alleles
 
Evidence of Evolution by Natural Selection - how basic evolutionary principal...
Evidence of Evolution by Natural Selection - how basic evolutionary principal...Evidence of Evolution by Natural Selection - how basic evolutionary principal...
Evidence of Evolution by Natural Selection - how basic evolutionary principal...
 
Vision for livestock genetics in Africa
Vision for livestock genetics in AfricaVision for livestock genetics in Africa
Vision for livestock genetics in Africa
 

More from ILRI

How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...ILRI
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...ILRI
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...ILRI
 
A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...ILRI
 
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...ILRI
 
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesPreventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesILRI
 
Preventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseasePreventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseaseILRI
 
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistancePreventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistanceILRI
 
Food safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesFood safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesILRI
 
Food safety research LMIC
Food safety research LMICFood safety research LMIC
Food safety research LMICILRI
 
The application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaThe application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaILRI
 
One Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldOne Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldILRI
 
Reservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaReservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaILRI
 
Minyoo ya mbwa
Minyoo ya mbwaMinyoo ya mbwa
Minyoo ya mbwaILRI
 
Parasites in dogs
Parasites in dogsParasites in dogs
Parasites in dogsILRI
 
Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...ILRI
 
Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...ILRI
 
Livestock in the agrifood systems transformation
Livestock in the agrifood systems transformationLivestock in the agrifood systems transformation
Livestock in the agrifood systems transformationILRI
 
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...ILRI
 
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsPractices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsILRI
 

More from ILRI (20)

How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
 
A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...
 
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
 
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesPreventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
 
Preventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseasePreventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne disease
 
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistancePreventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
 
Food safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesFood safety research in low- and middle-income countries
Food safety research in low- and middle-income countries
 
Food safety research LMIC
Food safety research LMICFood safety research LMIC
Food safety research LMIC
 
The application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaThe application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern Africa
 
One Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldOne Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the field
 
Reservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaReservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in Uganda
 
Minyoo ya mbwa
Minyoo ya mbwaMinyoo ya mbwa
Minyoo ya mbwa
 
Parasites in dogs
Parasites in dogsParasites in dogs
Parasites in dogs
 
Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...
 
Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...
 
Livestock in the agrifood systems transformation
Livestock in the agrifood systems transformationLivestock in the agrifood systems transformation
Livestock in the agrifood systems transformation
 
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
 
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsPractices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
 

Recently uploaded

Kalyanpur ) Call Girls in Lucknow Finest Escorts Service 🍸 8923113531 🎰 Avail...
Kalyanpur ) Call Girls in Lucknow Finest Escorts Service 🍸 8923113531 🎰 Avail...Kalyanpur ) Call Girls in Lucknow Finest Escorts Service 🍸 8923113531 🎰 Avail...
Kalyanpur ) Call Girls in Lucknow Finest Escorts Service 🍸 8923113531 🎰 Avail...gurkirankumar98700
 
The Role of Taxonomy and Ontology in Semantic Layers - Heather Hedden.pdf
The Role of Taxonomy and Ontology in Semantic Layers - Heather Hedden.pdfThe Role of Taxonomy and Ontology in Semantic Layers - Heather Hedden.pdf
The Role of Taxonomy and Ontology in Semantic Layers - Heather Hedden.pdfEnterprise Knowledge
 
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptx
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptxEIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptx
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptxEarley Information Science
 
Unblocking The Main Thread Solving ANRs and Frozen Frames
Unblocking The Main Thread Solving ANRs and Frozen FramesUnblocking The Main Thread Solving ANRs and Frozen Frames
Unblocking The Main Thread Solving ANRs and Frozen FramesSinan KOZAK
 
The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024Rafal Los
 
🐬 The future of MySQL is Postgres 🐘
🐬  The future of MySQL is Postgres   🐘🐬  The future of MySQL is Postgres   🐘
🐬 The future of MySQL is Postgres 🐘RTylerCroy
 
[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdf[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdfhans926745
 
Slack Application Development 101 Slides
Slack Application Development 101 SlidesSlack Application Development 101 Slides
Slack Application Development 101 Slidespraypatel2
 
Boost PC performance: How more available memory can improve productivity
Boost PC performance: How more available memory can improve productivityBoost PC performance: How more available memory can improve productivity
Boost PC performance: How more available memory can improve productivityPrincipled Technologies
 
IAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI SolutionsIAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI SolutionsEnterprise Knowledge
 
GenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day PresentationGenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day PresentationMichael W. Hawkins
 
Developing An App To Navigate The Roads of Brazil
Developing An App To Navigate The Roads of BrazilDeveloping An App To Navigate The Roads of Brazil
Developing An App To Navigate The Roads of BrazilV3cube
 
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure service
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure serviceWhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure service
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure servicePooja Nehwal
 
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...Drew Madelung
 
Salesforce Community Group Quito, Salesforce 101
Salesforce Community Group Quito, Salesforce 101Salesforce Community Group Quito, Salesforce 101
Salesforce Community Group Quito, Salesforce 101Paola De la Torre
 
How to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected WorkerHow to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected WorkerThousandEyes
 
Partners Life - Insurer Innovation Award 2024
Partners Life - Insurer Innovation Award 2024Partners Life - Insurer Innovation Award 2024
Partners Life - Insurer Innovation Award 2024The Digital Insurer
 
Presentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreterPresentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreternaman860154
 
A Call to Action for Generative AI in 2024
A Call to Action for Generative AI in 2024A Call to Action for Generative AI in 2024
A Call to Action for Generative AI in 2024Results
 
CNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of ServiceCNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of Servicegiselly40
 

Recently uploaded (20)

Kalyanpur ) Call Girls in Lucknow Finest Escorts Service 🍸 8923113531 🎰 Avail...
Kalyanpur ) Call Girls in Lucknow Finest Escorts Service 🍸 8923113531 🎰 Avail...Kalyanpur ) Call Girls in Lucknow Finest Escorts Service 🍸 8923113531 🎰 Avail...
Kalyanpur ) Call Girls in Lucknow Finest Escorts Service 🍸 8923113531 🎰 Avail...
 
The Role of Taxonomy and Ontology in Semantic Layers - Heather Hedden.pdf
The Role of Taxonomy and Ontology in Semantic Layers - Heather Hedden.pdfThe Role of Taxonomy and Ontology in Semantic Layers - Heather Hedden.pdf
The Role of Taxonomy and Ontology in Semantic Layers - Heather Hedden.pdf
 
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptx
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptxEIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptx
EIS-Webinar-Prompt-Knowledge-Eng-2024-04-08.pptx
 
Unblocking The Main Thread Solving ANRs and Frozen Frames
Unblocking The Main Thread Solving ANRs and Frozen FramesUnblocking The Main Thread Solving ANRs and Frozen Frames
Unblocking The Main Thread Solving ANRs and Frozen Frames
 
The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024The 7 Things I Know About Cyber Security After 25 Years | April 2024
The 7 Things I Know About Cyber Security After 25 Years | April 2024
 
🐬 The future of MySQL is Postgres 🐘
🐬  The future of MySQL is Postgres   🐘🐬  The future of MySQL is Postgres   🐘
🐬 The future of MySQL is Postgres 🐘
 
[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdf[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdf
 
Slack Application Development 101 Slides
Slack Application Development 101 SlidesSlack Application Development 101 Slides
Slack Application Development 101 Slides
 
Boost PC performance: How more available memory can improve productivity
Boost PC performance: How more available memory can improve productivityBoost PC performance: How more available memory can improve productivity
Boost PC performance: How more available memory can improve productivity
 
IAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI SolutionsIAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI Solutions
 
GenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day PresentationGenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day Presentation
 
Developing An App To Navigate The Roads of Brazil
Developing An App To Navigate The Roads of BrazilDeveloping An App To Navigate The Roads of Brazil
Developing An App To Navigate The Roads of Brazil
 
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure service
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure serviceWhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure service
WhatsApp 9892124323 ✓Call Girls In Kalyan ( Mumbai ) secure service
 
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
 
Salesforce Community Group Quito, Salesforce 101
Salesforce Community Group Quito, Salesforce 101Salesforce Community Group Quito, Salesforce 101
Salesforce Community Group Quito, Salesforce 101
 
How to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected WorkerHow to Troubleshoot Apps for the Modern Connected Worker
How to Troubleshoot Apps for the Modern Connected Worker
 
Partners Life - Insurer Innovation Award 2024
Partners Life - Insurer Innovation Award 2024Partners Life - Insurer Innovation Award 2024
Partners Life - Insurer Innovation Award 2024
 
Presentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreterPresentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreter
 
A Call to Action for Generative AI in 2024
A Call to Action for Generative AI in 2024A Call to Action for Generative AI in 2024
A Call to Action for Generative AI in 2024
 
CNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of ServiceCNv6 Instructor Chapter 6 Quality of Service
CNv6 Instructor Chapter 6 Quality of Service
 

Breeding and Genomics Research to Improve Livestock Productivity

  • 1. Breeding and genomics in ILRI biosciences research Steve Kemp ILRI BioSciences Day, Nairobi, 27 November 2013
  • 3. Livestock diversity Genome sequence determines characteristics: • Disease resistance • Drought tolerance • Productivity
  • 4. Livestock diversity Genome sequence MOSTLY determines characteristics, but what determines productivity in a given system? • • • • Genetics ? Feed ? Health ? Management ? That is a meaningless question!
  • 6. Contribution of 10 genes from Boran and N’Dama cattle to reduction in degree of trypanosomosis Boran (relatively susceptible) 15 10 5 0 -5 -10 -15 N’Dama (tolerant) 15 10 5 0 -5 -10 -15 The N’Dama and Boran each contribute trypanotolerance alleles at 5 of the 10 most significant QTL, indicating that a synthetic breed could have even higher tolerance than the N’Dama.
  • 7. Alignment of N’Dama ARHGAP15 with homologues H P mutation at AA282 Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK Pig Chicken KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK N'Dama (n = 35) Boran (n = 28) Gene frequency 282P-Allele 0.990 0.125 282H-Allele 0.010 0.875
  • 8. Alignment of N’Dama ARHGAP15 with homologues That mutationof AA282 H P piece at work took a lot of time and money. Cow NDama What has it really achieved? KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK Pig Chicken KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK N'Dama (n = 35) Boran (n = 28) Gene frequency 282P-Allele 0.990 0.125 282H-Allele 0.010 0.875
  • 9. The technology behind such ‘gene discovery’ has been transformed
  • 10. The technology behind such ‘gene discovery’ has been transformed
  • 11. The technology behind ‘gene delivery’ has NOT been transformed It is not rocket science! But that does not mean it is easy.. …and we need a complete pipeline
  • 12. The pipeline is therefore incomplete Genome sequence is now easy to obtain. Phenotype information is now HARDER to obtain. We need both.
  • 13.
  • 14. The technology behind ‘gene delivery’ has NOT (entirely) been transformed TALENS technology. Is somewhere along that pipeline and allows us to perform ‘precision crossbreeding’, or gene editing. We can now swap alleles at 100 genes in one go. But we don’t have 100 candidate SNPs, because the pipeline is dry. But we do have 2! We need to re-establish a genetics pipeline.
  • 15. We need to re-establish a genetics pipeline Sequence Conserve Phenotype Function Deliver to an animal Deliver to the user What traits? What species? What breeds? What target systems? Where to look for variation?
  • 16. Livestock diversity A cow is mostly non-cow: •Rumen sequence PARTLY Genome •Skin determines characteristics: •Milk • Disease resistance •Soil • Drought tolerance • Productivity Metagenomes play a role and interact with each other. So ‘describing a cow, suddenly became much more fun.